SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386836665|ref|YP_006241723.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836665|ref|YP_006241723.1|
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000124
Family SinR domain-like 0.04
Further Details:      
 
Domain Number 2 Region: 210-387
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000221
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 
Domain Number 3 Region: 81-190
Classification Level Classification E-value
Superfamily TPR-like 0.0000315
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 
Weak hits

Sequence:  gi|386836665|ref|YP_006241723.1|
Domain Number - Region: 406-437
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0942
Family DNA polymerase beta, N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386836665|ref|YP_006241723.1|
Sequence length 449
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MTENESLGSRIRRLRRAAGLSQEALARPDLSPSYISLVEAGKRIPSQEVIAQLAERLGCD
ASYLSEPLAEPDIADLGVEVRYAQLALRNGDAEAAFTTLTNLRLKVPATVTATDHRDVLF
SIDLGIAQCLEHKGNLEEAAVRFEALRQRCAEHERGRVEELSVVMSLCRCYRELGNLSHA
IQVAEETLAGVAELPPTIEYLELFSTLIGIYCERGDLHRAGFLASQAISHAEIITDRRAL
GGAYWNASAVLHRQGRSHEALALIKKAVAIYAEGDDERALARVRNAHATLLLQSEEANPE
AAKTLLEQSAATLRALGSSIDVAYVETAMARADVMLGRPDSAIEHAERALDLLGSEHRLE
SARVHLVIATAHLLRDDHEAVQAAYERGALLLEASEAGRQAAFAWSELAEILERSGENER
AVWAYRQGMQLLGHRSTLLSTRHRDVKGT
Download sequence
Identical sequences H2JPC7
gi|386836665|ref|YP_006241723.1| WP_014669198.1.21199 WP_014669198.1.57224 gi|474978940|ref|YP_007689406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]