SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386836730|ref|YP_006241788.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836730|ref|YP_006241788.1|
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.42e-23
Family DNA-binding N-terminal domain of transcription activators 0.0019
Further Details:      
 
Domain Number 2 Region: 120-271
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.88e-20
Family Multidrug-binding domain of transcription activator BmrR 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386836730|ref|YP_006241788.1|
Sequence length 274
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MFTIGDFGRHGRVSVRMLRHYDATGLLRPAHVDPASGYRHYTAAQLARLNRIIALKDLGF
SLRQVRDIVDEKVGAEELRGMLRLRRAELETAMAAAGARLVQVEARLRAIESEGHMPTND
VVIKTVPGVRVAELTATAASFDPEDIGPVIGPLYDELFRRLDSAGIAPTGPGVASYEDAP
EGGGRITVHAAVQVSAPLQDDGTFRVLDLPALDRAATIVHRGSMDTVLPTAQTLAHWIDA
GGYRSTGYPREVNLECPENRDEWVTELQAPVSRA
Download sequence
Identical sequences H2JPJ2
gi|474979005|ref|YP_007689471.1| gi|386836730|ref|YP_006241788.1| WP_014669263.1.21199 WP_014669263.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]