SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386836850|ref|YP_006241908.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836850|ref|YP_006241908.1|
Domain Number 1 Region: 90-219
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000286
Family DNA-binding protein Mj223 0.063
Further Details:      
 
Weak hits

Sequence:  gi|386836850|ref|YP_006241908.1|
Domain Number - Region: 5-40
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000765
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386836850|ref|YP_006241908.1|
Sequence length 251
Comment hypothetical protein SHJG_0758 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPGGRLTQQERQQIALGLADGLAYAEIARRLGRPTSTITREVMRNGGPTAYRAELAHRAT
ERRARRRRPASSRGPQSVPPSHGRDAEAVAEYEEALTTVLMASGLPKMTARVLTCLFTTD
AGSLTASELAQRLQVSPASVSKAITFLEGQSLVRRERDERRRDRYVVDDELFYQATIASA
RANDRLVETARRGVTVLGPHTPAATRLENIARFLDFISESITRAAEQAREVLHTKPATAP
NDTTRPGPHHG
Download sequence
Identical sequences H2JS84
gi|386836850|ref|YP_006241908.1| gi|474979125|ref|YP_007689591.1| WP_014669383.1.21199 WP_014669383.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]