SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386836893|ref|YP_006241951.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836893|ref|YP_006241951.1|
Domain Number 1 Region: 865-923
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 9.86e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0054
Further Details:      
 
Domain Number 2 Region: 8-95,141-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000428
Family Extended AAA-ATPase domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|386836893|ref|YP_006241951.1|
Domain Number - Region: 734-837
Classification Level Classification E-value
Superfamily TPR-like 0.0055
Family CT2138-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386836893|ref|YP_006241951.1|
Sequence length 965
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MIRGRVEEDPLDGIIGREPEISRLLRGLFPNRAEDAGALLLVGEPGMGKTALLHAVAAEA
GQRGTVLRCAGSQAERTLAYGALHQLLRPVLNHLPELPAPQGAALSRALGMRHTAARTAD
AEGGDERLLVGLASLNLLLASASHRPVTIVVDDLQWLDDASLESLLFVARRTAGEPVGLL
AAVRGDGVSGPGWPDFEPVPLGPLSGEAAGRLLDAQPVVPRGRVRGQVLRLAAGNPLALL
ELARDAEERGFPGWDTAVGAGFSLPARLEKAFAERLDGLPEATRRVLLFAAAADGPDMRA
ALSAAASVPGGGAEAWAAAEDAGLVRLVSGRVEFRQPLMRSAVYATASFAERREVHLRLA
DGLDGDPDRRAWHRAAASLAPDESVAGALVETADRARRRGGYRVAAAALERAAQLSERGW
SRARRLLDASDLAVHAGEPWWVEALTGEVAAATDDPGMLAEAALRRGWALAATGRQKAAL
SQLLPLAADMMDASPVTALDAVSHSAVVLYCSGDEVFRRQAQELLARVPGEVGSAYEQVW
ARACCDPFGDRRGALAALHRAAAEADGVPGRLSVLGGAAWILDETALGVRLLSAVMERLR
TVTTAGSSAMVGQTLALAQFDAGAWEAACESAEDARRVAEENGLEAAAWVAVYVSAMVLA
LRGEDARGLMARAVRGLDMSESRALGVRMAMVRAAVAAAEGDHALEFELLRGLFTAGPDP
RPVHYHCSLYGVGDLAAAAVRVGRPEEAVETVDAVERWVGEGMSPRLRLIVGRARALLCE
GEEAEELFRTVVGDPVGEQWPFERAVVSLEFGEWLRRRRRMSEARAELARALTVFERLKA
HPWVERTAGELRACGVPVRDAEGHPGSVERLTPQQLQIARLAAAGLTNRQIGERLLLSAR
TVGFHLYQAFPKLGVSSRTQLRDALSRAQSPREGTPDHASGTVSRPTARPVAGPDETPSR
LVSRR
Download sequence
Identical sequences H2JSC7
gi|474979168|ref|YP_007689634.1| gi|386836893|ref|YP_006241951.1| WP_014669426.1.21199 WP_014669426.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]