SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386837028|ref|YP_006242086.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386837028|ref|YP_006242086.1|
Domain Number 1 Region: 92-292
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.42e-30
Family Phosphate binding protein-like 0.0025
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.84e-24
Family LysR-like transcriptional regulators 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386837028|ref|YP_006242086.1|
Sequence length 292
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MFTLTQLTCFVAVAEELHFTRAAERLSMTQPPLSRQIQLLEGELGVRLLDRTNRTVRLTP
AGRSFLAEARRIVRQAEHAALAVRRVSTGEAGSIAIGFTAASAYSALGELLESARRALPR
VEILLHELVTRDQLEALSEGSLDLGLIRPSAVGPDLTARTAVREGLVAALPADHALAADD
GPMELSAFDGEDFLMYSPTEARYFHELLLTTFRSAQVRPVFTQYLSQVHSILALVNIGWG
IALVPEAAAEMRPTGVVYRPLHLPGHPRPVELDYVWRKSNDNPALHALLQLL
Download sequence
Identical sequences A0A0S2PGD9 A0A101PV04 H2JV14
gi|386837028|ref|YP_006242086.1| gi|474979303|ref|YP_007689769.1| WP_014669559.1.21199 WP_014669559.1.28171 WP_014669559.1.57224 WP_014669559.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]