SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386837361|ref|YP_006242419.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386837361|ref|YP_006242419.1|
Domain Number 1 Region: 5-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000076
Family SinR domain-like 0.053
Further Details:      
 
Domain Number 2 Region: 150-333
Classification Level Classification E-value
Superfamily TPR-like 0.00000358
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386837361|ref|YP_006242419.1|
Sequence length 429
Comment hypothetical protein SHJG_1269 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLEQPHFGRRLKRLRLERGLSQAGLVGDGMSTGYLSRLESGERRPTERATAYLAERLGVD
ASALIGPSPQRSLTCELAAVSSAPSGTYDIAALGRAVDEDAGDDPATRWQALWLLSRAAD
RLGDYSQERGRLLQLLDLSELLEVPELRVRSYVQYARCLRALGDMRTAEPAAAQAYSLAR
AEEVSVADTTAALMVLIGIEVELGRLDEAARHVDELERDWLPMAAPAQAAEGWWTVAMVR
NRQGDHASARTGLETALGLLEGRDDLTLWIRLRAAAAAAALEMSPPRLAAAERWLREAVS
VVDLIGTPVQVQELRALQAHLAFHQGRTDEARAISGALLAEEDLRLPYRDRVRLSVLDGR
LKILSGRADEGIDLLQRLGRQAAESQNLDLAAHVWQSLAQTLADLRLPHTADSADTTPQP
SDQGDRARP
Download sequence
Identical sequences H2K187
WP_014669892.1.21199 WP_014669892.1.57224 gi|474979638|ref|YP_007690104.1| gi|386837361|ref|YP_006242419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]