SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386837946|ref|YP_006243004.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386837946|ref|YP_006243004.1|
Domain Number 1 Region: 10-63,206-441
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.18e-55
Family Bacterial dinuclear zinc exopeptidases 0.0000233
Further Details:      
 
Domain Number 2 Region: 93-200
Classification Level Classification E-value
Superfamily PA domain 0.00000000000275
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386837946|ref|YP_006243004.1|
Sequence length 450
Comment aminopeptidase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPADILAKKMSQAVTGEKAWRHLEAISEATAANGGHRADGSPGYDASTQYLTRTLTAAGY
KVKRQEFSFLDYEIFSEKASVTAPNPRTLTPIIARFSISTPEGGLTAPVVVPSGKSTGCT
ANDYAGQDVKGKIVLVDVNDCFITQKQITASEMGAVAVLMNVNAPNPQLNLRYRMVPPED
ARIPIATLNRGEAEQLKSDIAAGPVTVNVDLRGRNKMTKTYNLLADTPTGRADNTVVMGA
HIDSVDTTPGMNDNAAASAMLLETAVQMAPYWKHVKNRVRFAWWAAEEKGISGSQYYVDQ
LNEADRSGTALYLNLEMIGSPNFLRQVYNGQTADGPGPAGSDRISGLIGGYFADRGLPTA
GLVLDGRSDHSPFIAAGIPAGGVNAGSDAVKTPEQAKVFGGTVGEMLDPCYHQACDTLAN
VNRTIFEQNGRAMAWAVGRFAVDTSDVNGK
Download sequence
Identical sequences A0A101QD73 H2JN67
WP_014670471.1.21199 WP_014670471.1.28171 WP_014670471.1.57224 WP_014670471.1.88765 gi|386837946|ref|YP_006243004.1| gi|474980155|ref|YP_007690621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]