SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386837953|ref|YP_006243011.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386837953|ref|YP_006243011.1|
Domain Number 1 Region: 154-447
Classification Level Classification E-value
Superfamily Subtilisin-like 7.86e-82
Family Subtilases 0.00000554
Further Details:      
 
Domain Number 2 Region: 743-854
Classification Level Classification E-value
Superfamily PA domain 0.0000157
Family PA domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|386837953|ref|YP_006243011.1|
Domain Number - Region: 1137-1190
Classification Level Classification E-value
Superfamily E set domains 0.0098
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386837953|ref|YP_006243011.1|
Sequence length 1206
Comment secreted peptidase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MRPGPGREHIPFETLEEDDKSLTVLPWDAEGLVSAGALDRRLFDVTALISQGYDEAHTSA
LPLIVSSEPSRKGAGVTAEAARAAAATADRLVALNAPGTPSRNLPSIHARSLRVADRRLG
TFWKTLNPGGKTGVARAALTPRVSLDGRVKAVLDRSTAQINAPTAWKAGDEGQGVKVAVL
DTGVDASHPDLAGRITEAVDFSNSSNTDDHFGHGTHVASIVGGSGAASGGTRRGVAPRAD
LLIGKVLGDDGYGSESAVIDGMQWAAREHAKVVNMSLGSGSATDGTDPLSQAVDSLTASS
GALFVVAAGNEGETGPSSVGSPGAADAALTVGAVDRDDSLAPFSSRGPRLGDGTVKPDVT
APGVGIIAARASGTTLGDPVDAHYVALSGTSMATPHVAGAAALLAQRHPDWDAQQLKDAL
ISTAHTVPHTQVTEQGGGRIDVATAMGPVRASGSVSLAPLTTGGSGGRQQSATVRYTNSG
DRPVTLSLALGLATASGRALPDGVVGLGSDTVRLAPGATAEVPLSTDARNAVRGTYYGYL
TAKSADGAVLTHTTVSLAVHAPQHRLTVFYRDRDGKVMPDWLPTIWGPDGFVDYTDRQAH
VALVEEGTYYVSSAFYDMTDHGGEAGTVVAPEVKVTKDRTVTLNAAEATQVHIRTPRPAE
QHGILSTTVYRRIDGHGLVQGVMYFDDVTRLYVSPTSRVTDGAFEFSSRWQMVAPQLRAK
VSGGSREFVPFYEPDSSVFPDRGARLTAVDAGTSSAPDFRRARGKLAVVRYDFSVTEPEL
ARSAAKAGAKALLMVWPQEQGSAWTRWQPTGDRTALPSMRASWKDGTALLERVEKGTTTV
AFSGTVRSPYLYDVMQVSKDFVPKQVVHTVSERESAVVRSTYTRTGAALWASEQRFGWRP
YQDTAWNQYSRYVPVGRERVEYVTGGDTLWNHVVHHDVVDVPDLPLAAGMRNAPRTYRPG
GHVTETWFGAPVRPSIPRGWTRPSVRTGDTLTVYVPEFTDSDAGHWSFAERSGFGVGRAS
AADDVASAVLYRNGERTAVSDDGAWGSFEVAPGDARYRLDLTTARVSDDWRLGVRTRTSW
TFRSDTTADAAPLSLLQLDYDVPVDAQGAVSRARAQRLGLTVRMQDGMAAPRGVRLKAEA
SYDGGKTWTTARTERHGDGRRFTATVERPSKVRGDAYVTLRVTATDSAGDSVRQTVERAY
LHRGTA
Download sequence
Identical sequences H2JN74
WP_014670478.1.21199 WP_014670478.1.57224 gi|386837953|ref|YP_006243011.1| gi|474980161|ref|YP_007690628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]