SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386838033|ref|YP_006243091.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386838033|ref|YP_006243091.1|
Domain Number 1 Region: 100-268
Classification Level Classification E-value
Superfamily TPR-like 2.85e-26
Family BTAD-like 0.0015
Further Details:      
 
Domain Number 2 Region: 271-490
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.86e-23
Family RecA protein-like (ATPase-domain) 0.037
Further Details:      
 
Domain Number 3 Region: 706-881
Classification Level Classification E-value
Superfamily TPR-like 3.41e-20
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 4 Region: 4-84
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000312
Family PhoB-like 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|386838033|ref|YP_006243091.1|
Domain Number - Region: 538-594
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000218
Family Plant O-methyltransferase, N-terminal domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386838033|ref|YP_006243091.1|
Sequence length 945
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MSVRFAVLGPVRVWRGAEELDAGGPQARALLALLLLRAGQPVPVPEIVDVLWGPGPPPTA
LNVVRRHVGSLRRLLEPGLPARTPGHRLVRGAGGYRLVTDGDDVDLARFRALRQEARRAV
AEGAPGRAVELLGRALTLWAGPVASGLAPDVRERLGADGLERERLAALREAADAALQAAV
PGAVLARLREAAAAHPLDEPLLARLVLALAATGRRAEALATCRDACRRLAEELGLDPGPE
LQEAHRTALGGTGDGDPVEPPLAEAVVARPVVPAQLPHDLPAFTGRHTELAELLDPLAGG
EPVGTVLVSALGGMAGVGKTTLAVHWAHRVADRYPDGQLYVDLRGFAASAAVTDPGEAVR
GFLHALGVPPEHVPQGLAAQAALYRSVLAGRRVLVLLDNARDAEQVRPLLPGTPGCLAIV
TSRDDLTGLVAAHGARSLTLRPFDAGQSRDFLAGRLGAERTAAEPRAVDEIVARCAGLPL
ALACVAARAALRPDFPLAAVAAELREARGGLAGFTRPGTPVDVATVFSWSTRAVSSAAAR
LFRLLALHPGPDLSAATAAALAGLPPRRARSLLAELAAVHLVTEPAPGRYGFHDLLRAHA
GDLLAEHHSEAERQEARDRLFRHYVERAHTAGMLLDPSGDAPAPAPAPPDPRAVPFADDS
AALAWLTAEHPALSAVLRAAATTGHDRYACLLAWSLEPYFERRAHWHDGLAAQRTALDAA
LRLADPALEARALRGLARAEGRLGLSDESRAHLDRALTLFTLAGDTVGRAGTHRSLGWAC
EQEGDLAGALRHNQLALELYRAAGSRPAQASVLNSVGWYHALRGEYRPALARCFEALALL
QDLGDRYGQAAAWDSIAYAYHCLGRHPHALLGYRNALTLYRALGVPYPEADTLTRMGDTH
LATGDREGARAAWEQALALLTRLGHPDAERVRERLAGREERSGAG
Download sequence
Identical sequences H2JPT0
gi|386838033|ref|YP_006243091.1| WP_014670558.1.21199 WP_014670558.1.57224 gi|474980242|ref|YP_007690708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]