SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386838366|ref|YP_006243424.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386838366|ref|YP_006243424.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.87e-112
Family FMN-linked oxidoreductases 0.00000000167
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.77e-44
Family N-terminal domain of adrenodoxin reductase-like 0.00000816
Further Details:      
 
Domain Number 3 Region: 461-519,555-649
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.31e-23
Family C-terminal domain of adrenodoxin reductase-like 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386838366|ref|YP_006243424.1|
Sequence length 671
Comment 2,4-dienoyl-CoA reductase (NADPH) [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MSRYPHLMTPLDLGFTTLPNRVLMGSMHVGLEEAERGFERMAAFYAARARGGVALIVTGG
IAPNEEGRPYEGGAMLTTEAEAERHRTVTEAVHREGGRIAMQILHFGRYAYHQELVAPSP
LQAPISPLVPRELTDADVERTIEDYARAARLARRAGYDGVEIMGSEGYLINEFIAARTNR
RTDRWGGCYENRMRFPVEIVRRVREAVGEDFIVIYRLSMLDLVPGGSSLDEVIALGKAVE
AAGATIINTGIGWHEARIPTIATSVPRGAYTWVTRKLMGQVSVPLVTTNRINTPELAERL
LADGYADMVSLARPMLADPDFVAKAAAGTPEAINTCIGCNQACLDHTFSGQITSCLVNPR
ACHETELVLAPTRLKKRVAVVGAGPAGLACAVTAAERGHTVTLFDAASEIGGQLNVARKV
PGKQEFDETLRYFRHQLDVHGVDVRLETWVEAGDLEDFDEVVVATGVTPRTPDIPGADHP
RVLGYLDVLRDGAPVGDRVAVLGAGGIGFDVAEFLTDGGDKAGEDPETYFRNWGVDTAYR
APGGLAAPERPAPPRQVHLLQRKTSKVGAGLGKTTGWIHRTELKHRGVTMVPGVRYDRID
DAGLHITVGDESTVLEVDTVVLCTGQEPRRELYEELVAAGRGAHLIGGADVAAELDAKRA
IKQGTELAAAL
Download sequence
Identical sequences H2JWJ8
gi|474980575|ref|YP_007691041.1| gi|386838366|ref|YP_006243424.1| WP_014670891.1.21199 WP_014670891.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]