SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386838647|ref|YP_006243705.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386838647|ref|YP_006243705.1|
Domain Number 1 Region: 104-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.11e-49
Family C-terminal domain of adrenodoxin reductase-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 2-116,143-167
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000000000000706
Family N-terminal domain of adrenodoxin reductase-like 0.00038
Further Details:      
 
Weak hits

Sequence:  gi|386838647|ref|YP_006243705.1|
Domain Number - Region: 323-441
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00106
Family N-terminal domain of adrenodoxin reductase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386838647|ref|YP_006243705.1|
Sequence length 446
Comment NADPH-ferredoxin reductase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLRVAVVGSGPSGCYTAQGLVQRDPEVLVDVLDRLPCPYGLVRYGVAPDHEKIKSLQNSL
RTVLEHERVRFLGGVRVGGPGGLPAQRLRGIYHAVVYCVGAATDRRLGIPGEDLPGSWSA
TEFVSWYSAHPDAVDAGFLRGVRSAVVVGVGNVAVDVTRMLVRGAAELRPTDIPQAALDT
LAASGLTEVQMVGRRGPAQARFTTKELRELGGLPDTDVIVDKAELALDPADPGALPAGPR
RNVEVLRDWAARPPAVAAARRIRLRFFLRPVELLADGGRVGAVRFERTAPDGTGGVTGTG
RYEDVPAQLVLRSVGYRGVPLEGLPFDPASGTVPHQEGRVLRDGVPSPGEYVAGWIKRGP
TGVIGTNRPCAKETVTSLLADAPALGRADLPQDPVAALRAAGVEPVPWDGWLAIERAEAE
LGARLGRSVVKLSDWDALLGAARVLS
Download sequence
Identical sequences H2K1F9
WP_014671172.1.21199 WP_014671172.1.57224 gi|386838647|ref|YP_006243705.1| gi|474980855|ref|YP_007691321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]