SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386838730|ref|YP_006243788.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386838730|ref|YP_006243788.1|
Domain Number 1 Region: 180-382
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.2e-45
Family ATP-dependent DNA ligase catalytic domain 0.0005
Further Details:      
 
Domain Number 2 Region: 384-503
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.43e-31
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0018
Further Details:      
 
Domain Number 3 Region: 5-202
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 9.55e-28
Family ATP-dependent DNA ligase DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386838730|ref|YP_006243788.1|
Sequence length 512
Comment ATP-dependent DNA ligase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLLTRLAQVSREVAATAARSRKIALLAELFRDAEADDVPIVIPYLAGRLPQGRLGVGWKV
LGRPVPPAAEPSLTVREVDARLTGLGKVSGPGSQAERTRIVGELMGAATEEEQRFLLGLL
TGEVRQGALDAVAVEGLARATGADPADVRRAVMLAGSLQTVAQALLGEGPGSLDRFRLTV
GRPVLPMLAHSASSVAEAVEKLGACAVEEKLDGIRVQVHRDGDTVRIHTRTLDDITGRLP
EVTSAALELGGERFILDGEVISFDAAGRPRSFQETAGRVGSRTDVARAAGQTPVSPVFFD
ALSVDGRDLLDLPFAERHAELARLVPEPMRVRRTVASGPEDIPEAERFLADTLARGHEGV
VVKALDAPYSAGRRGAAWLKVKPVHTLDLVVLAAEWGHGRRTGKLSNLHLGARTPDGGFA
MLGKTFKGMTDAMLAWQTERLKELAVEDNGWVVRVRPELVVEIAYDGLQRSTRYPAGVTL
RFARVVRYREDKRPEEADTVEALLAAHPEVSP
Download sequence
Identical sequences H2K393
gi|474980939|ref|YP_007691405.1| WP_014671255.1.21199 WP_014671255.1.57224 gi|386838730|ref|YP_006243788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]