SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386838870|ref|YP_006243928.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386838870|ref|YP_006243928.1|
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.44e-21
Family PadR-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386838870|ref|YP_006243928.1|
Sequence length 127
Comment PadR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MHGYEMIQEIAERSGGAWKPSPGSVYPTLQLLEDEGLIASESEGGKKLFALTESGRAAAD
EGPDAPWEEASRGVDWEALTEIRQAGFGLMEAFGQVWKTGSKEQREKALAVINDARKKLY
LILADED
Download sequence
Identical sequences A0A0S2NVW7 A0A124HKE2 H2K6V2
gi|474981079|ref|YP_007691545.1| gi|386838870|ref|YP_006243928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]