SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386839072|ref|YP_006244130.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386839072|ref|YP_006244130.1|
Domain Number - Region: 11-91
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0518
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386839072|ref|YP_006244130.1|
Sequence length 119
Comment integral membrane protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLNALTLVTGVAALLLAAWCGWAAYRDQPTKDWHFIGMAVVSLLALVQLVIGIVQLARGE
KPEQGTTIFVAYLLGAFACVPAAGFMSLAERTRWGSVTVAAGGVVLAVLEVRLFDIWGG
Download sequence
Identical sequences A0A0S2NX46 A0A117QC36 H2JKC0
gi|386839072|ref|YP_006244130.1| gi|474981281|ref|YP_007691747.1| WP_014671592.1.21199 WP_014671592.1.28171 WP_014671592.1.57224 WP_014671592.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]