SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386839216|ref|YP_006244274.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386839216|ref|YP_006244274.1|
Domain Number 1 Region: 12-206
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.8e-23
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386839216|ref|YP_006244274.1|
Sequence length 208
Comment hypothetical protein SHJG_3127 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MSLRAETPAPPSARVHRFTRAERWVHRATAALMGVCVMTAAVLYIPQLAVLVGRRELVVR
VHECAGLALPVPVLLGLASRAFRADLRFLNRFGPHDRVWLRAALRRDRRHGSRPAGKFNA
GQKVYAAWIAGATLVMLGTGLMMWFTRLTPLMWRTSATFVHDWLALTIGVVLAGHIGMAL
GDPEARRGLRTGSVSEEWANREHPLWRP
Download sequence
Identical sequences A0A101PUE4 H2JND3
gi|474981425|ref|YP_007691891.1| WP_014671735.1.21199 WP_014671735.1.28171 WP_014671735.1.57224 gi|386839216|ref|YP_006244274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]