SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386839715|ref|YP_006244773.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386839715|ref|YP_006244773.1|
Domain Number 1 Region: 23-300
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.4e-64
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386839715|ref|YP_006244773.1|
Sequence length 545
Comment cytochrome b subunit [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MSTAANETSRPRGKAPAGERLADWADGRLGIYSLAKANMRKIFPDHWSFMLGEVCLYSFI
IIILTGVYLTLFFHPSMNEVEYHGSYVPLQGQLMSEAFSSTLHISFDVRGGLLIRQIHHW
GAVVFIAGMFVHMMRVFFTGAFRKPREVNWLFGFLLLVLGMFTGFTGYSLPDDLLSGTGV
RFMEGAILSVPIVGTYISFFLFGGEFPGGDFVARFYSIHILLLPGIMLGLVVGHLILVFY
HKHTQFTGPGKTNKNVVGMPLLPVYMAKAGGFFFLVFGVLAALAAVAQINPIWAIGPYRP
DQVSTGAQPDWYMGMAEGLIRAMPGWEINFWGHTLVLGVFIPLVLFGVILGAIAMYPFIE
AWVTGDKREHHILDRPRNAPTRTAFGVAWLTVYFVMLIGGGNDIFATHFHLSINAVTWFV
RIAYFVAPVLAFIATKRICLGLQRRDRDKVLHGRETGIIKRLPHGEFIEVHEPLSQEQLH
TLTSHEQYRPAEIGPTVDENGVERKVPASEKLRAKLSNAYFGEDNQIPKPTVEEYKEITS
GHGHH
Download sequence
Identical sequences A0A0S2NYU6 A0A101Q971 H2JWZ7
gi|386839715|ref|YP_006244773.1| gi|474981926|ref|YP_007692392.1| WP_014672232.1.21199 WP_014672232.1.28171 WP_014672232.1.57224 WP_014672232.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]