SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386840110|ref|YP_006245168.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386840110|ref|YP_006245168.1|
Domain Number 1 Region: 22-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.8e-40
Family G proteins 0.00019
Further Details:      
 
Domain Number 2 Region: 198-317
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 9.81e-35
Family Prokaryotic type KH domain (KH-domain type II) 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386840110|ref|YP_006245168.1|
Sequence length 317
Comment GTP-binding protein Era [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MSVRTQTSEQPAETVHRAGFACFVGRPNAGKSTLTNALVGQKVAITSNRPQTTRHTVRGI
VHRPDAQLILVDTPGLHKPRTLLGERLNDVVRTTWAEVDVIGFCLPADQKIGPGDRFIAK
ELAGIRKTPKVAIVTKTDLVDSKALAEQLIAIDQLGKELGIEWAEIVPVSAVGSKQVDLL
ADLLVPLLPEGPALYPEGDLTDEPEQVMVAELIREAALEGVRDELPHSIAVVVEEMLPRE
DRPADRPLLDIHANVYIERPSQKGIIIGPKGKRLKEVGIKSRKHIEALLGTPVFLDLHVK
VAKDWQRDPKQLRRLGF
Download sequence
Identical sequences A0A0S2NYT5 A0A101QM00 H2K5D4
gi|474982321|ref|YP_007692787.1| WP_014672627.1.21199 WP_014672627.1.28171 WP_014672627.1.57224 WP_014672627.1.88765 gi|386840110|ref|YP_006245168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]