SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386840260|ref|YP_006245318.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386840260|ref|YP_006245318.1|
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-41
Family Protein kinases, catalytic subunit 0.00099
Further Details:      
 
Domain Number 2 Region: 402-510
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000022
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386840260|ref|YP_006245318.1|
Sequence length 644
Comment serine/threonine protein kinase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPKLRAGDIVRGQYEVAGCLAHGGLGWVYLAVDRAVSDRWVVLKGLLDTGDQDAMAAAIS
ERRFLAEIEHANIVRIYNFVEHLDQRTGSLDGYIVMEYVGGKSLKEIANARRTPEGRRDP
LPVEQACAYGIEALEALGHLHSRNLLYCDFKVDNAIQTEDQLKLIDMGAVRRMDDDESAI
YGTVGYQAPEVAESGPSVASDLYTVARTLAVLAFDFQGYTNVYADSLPDPDTIEVFRRYE
SFYRFLVRATDPDPGRRFASAQEMAEQLTGVLREVVSLQTGRARPALSTLFGPETKVTDT
ELFPRLHGDVSRLGARPVRKAPATPAPPPPALVRPVDTPAAALALPVPLVDPNDPGAGFL
AGLTASAPAELMSALAAAPARTVETRLRQIRARLESGDHQGALTSLAELDEEQGDDWRVV
WYRGVAALVTGDFEHAALAFDAIYDAFPGEAAPKLALGLCAEVLGQLDNAAEYYHLVWTT
DPSFVSAAFGLARVRLAAGDRRGAVTTLESVPESSIHYTAARVAAVRARLRQRTASAGDV
PFLDDLTAAAGQVEALQAYGLDPARRELLSAEVLGCALDWILSGGQGTGPAAGGRVLLGS
GLDERGLRFGLERAYRTLARLAPGGDERIELVERANRYRPRTWV
Download sequence
Identical sequences H2K905
gi|386840260|ref|YP_006245318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]