SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386840490|ref|YP_006245548.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386840490|ref|YP_006245548.1|
Domain Number 1 Region: 87-338
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000417
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 318-464
Classification Level Classification E-value
Superfamily TPR-like 0.00000000337
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386840490|ref|YP_006245548.1|
Sequence length 482
Comment hypothetical protein SHJG_4404 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MGTSLVPEPPAPRRRVLRRVLVASLAGGVVAGTVLMLLPHERRHGPAAPPAAGPEARPRA
QVPVLTTVTYGVPAALPGLTALIGRQERLVRAQPRDARAWAVLGSAYVERGRRAGDAADY
PKAERALRESLKVRGGRNTEALDGLAALALARRDFPAAKGYGEQALKAAPKRWQAYPPLI
DAYTGLGDYEKARSTLDKLLALRTDAAARPAVMARASAVYRDRGWREDAVAQLTDAAAAA
RTPAEQAAWLAGLGQLAWERGDLADALRHFEAALRLDPDQRPAATGRARTLAALGHTPQA
LAAYRAVVAKQPNPADLLELGELYESLGQPGVAEEQYTRMKEAVRRAVSGGVDEEVLIGR
YEADHGDPWDGVERLREEWRRQPGIEVADALGWALHRAGEDEEALTFATTATDKAKGGGV
RSALYAYHRGVIEAELERYAPARRHLEEALRINPYFSPLKAPLAREALRELGDVPDEPPP
SE
Download sequence
Identical sequences H2JNK9
gi|386840490|ref|YP_006245548.1| gi|474982700|ref|YP_007693166.1| WP_014673005.1.21199 WP_014673005.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]