SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386840799|ref|YP_006245857.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386840799|ref|YP_006245857.1|
Domain Number 1 Region: 85-254
Classification Level Classification E-value
Superfamily TPR-like 2.13e-35
Family BTAD-like 0.00077
Further Details:      
 
Domain Number 2 Region: 253-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.32e-26
Family Extended AAA-ATPase domain 0.047
Further Details:      
 
Domain Number 3 Region: 749-936
Classification Level Classification E-value
Superfamily TPR-like 3.28e-16
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 4 Region: 10-67
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000765
Family PhoB-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386840799|ref|YP_006245857.1|
Sequence length 955
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MRAWHGEEALSTGSPQQRALLAALLLREGRTATAAELIDALWGPEPPSQALAAVRTYASR
LRKVLSQGVLISESGGYAIRGLREGALDLAVAQDLAAEAEKARGTGELGRARALLNQALD
LWDGEPLAGVPGPYAEAQRARLEEWRLGLLETRLDLDLEQGCHAEAVSELTALTAAHPLR
ERLRELLMLALYRSGRQAEALAVYADTRRLLSEELGVDPRPGLRELQQRILQADPALAEP
SAPVTEPTAAPVRPAQLPASVPDFTGRSSFVTDLTEVLSSASEAGGRVMAVSALAGIGGV
GKTTLAVHVAHRARPVFPDGQLYVDLQGAGPRPAEPETVLGSFLRALGTPDTAIPDSLEE
RSALYRSVLDGRRVLVLLDNAKDAAQVRPLLPGTEGCAALVTSRVRMLDLAGAHLVDLDV
MSPDEALALFTRIVGEERVAAEREAALDVVAACGFLPLAIRIAASRLAARRTWTVSVLAA
KLADERRRLDELQAGDLAVKATFELGYGQLEPAQARAFRLLGLADGPDISLAAAAAVLDL
PPEDTEDLLESLVDTSLLESAAPGRYRFHDLVRLYARSCAERDEWPPSEREAAMSRVLDF
YLATAARVYAMERPGDRLVDDLEGTRYPGLRFTEGAAALDWLYTEAGPLLACVRQAVGTQ
RLRRAVDLLWAAKDLTESGANSHQYEMTARAMCEATRDAEDARAEGRARTTLTNVLLVSG
RIHQASEAAELAMQLAESAGDATAVSWVANDRGLISLHQGRFHDGRAFFEQAIEGHRDAG
NRLGEAVTLANLSRAYLGMGKVTKAVEIAQHGLAVHAEIGRPMRRANAHFALGLALTKAG
RHTEALSQLSDAQDIFTEHRQRLWVGNTHFRIAEVHLAAQSPAQAAQHAEQALALGCVGG
DRMRGNVLTLLGRALSVLGQADRAKACWREALNLYEQNGAEEAQVVRGLLAPTIA
Download sequence
Identical sequences H2JUC6
gi|386840799|ref|YP_006245857.1| gi|474983008|ref|YP_007693475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]