SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386840956|ref|YP_006246014.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386840956|ref|YP_006246014.1|
Domain Number 1 Region: 6-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000242
Family Phage repressors 0.075
Further Details:      
 
Weak hits

Sequence:  gi|386840956|ref|YP_006246014.1|
Domain Number - Region: 298-363
Classification Level Classification E-value
Superfamily TPR-like 0.00043
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386840956|ref|YP_006246014.1|
Sequence length 394
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPSRDDDHTGARIREQRRLARLTQRQLAERLPYSYSYLNQVECGARPATAAFVAACARAL
TIDVTVLTGQPYVTELQRDRLAELVRPIRESLDLYDLGPDPELTPRPAQQLIAGADRLCV
EVRATRLRSAARDLPGLIAELTHAACSTPSTELWWALASAYRTAHDISVKLGYYDLSTVA
LDRMDWAAHRASDPYLAAVRQYMRALVYFREGEYRIGQRLIAAGHDMIAQNDPSREALAV
VGQLHLGGAVIAARAERQSSVGQHIAEAHRIAERIGDASDVHWLSFGPANVALHQMSAAV
EMCQYDEAMKQAQGIELPPPLPTSRRAHFLIERARAEMETGHTDAALKSLVEARRLAPEQ
TRYHPAARETITGLVHQSRRTPETLNHMAAWVGL
Download sequence
Identical sequences H2JX46
gi|474983167|ref|YP_007693633.1| gi|386840956|ref|YP_006246014.1| WP_014673465.1.21199 WP_014673465.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]