SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386841179|ref|YP_006246237.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386841179|ref|YP_006246237.1|
Domain Number 1 Region: 13-213
Classification Level Classification E-value
Superfamily Prim-pol domain 4.25e-34
Family Bifunctional DNA primase/polymerase N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386841179|ref|YP_006246237.1|
Sequence length 290
Comment hypothetical protein SHJG_5096 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MATIDRQATTLALAHALSAAERGLAVIPLSRTKLPALRSPHRDDPNPPGRPCHGECGRFG
HGVYDASTDPVRIRELFAAAPWATGYGIACGLPPYHLIGVDLDTKSGTDSSAALRELALR
HLFTIPETVVVLTPSGGRHLWLTGPPDTVVPNSAGRLAPGIDIRGAGGYLVGPGSRTDHG
VYTAAPGTADLAPASCPPFLLRLLLPPPRAPHPTRPAAGDHGQGLVQFVLAAHEGQRNTR
LFWAACRAYENGIGPALADPLVAAARDTGLTEREARATIASAARLTGHRP
Download sequence
Identical sequences H2K1W3
gi|474983390|ref|YP_007693856.1| gi|386841179|ref|YP_006246237.1| WP_014673683.1.21199 WP_014673683.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]