SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386841294|ref|YP_006246352.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386841294|ref|YP_006246352.1|
Domain Number 1 Region: 68-253
Classification Level Classification E-value
Superfamily Rhomboid-like 3.92e-45
Family Rhomboid-like 0.00065
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000939
Family B-box zinc-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386841294|ref|YP_006246352.1|
Sequence length 281
Comment hypothetical protein SHJG_5211 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPVCYRHPDRETGVRCTRCERPICPECMISASVGFQCPDCVREGSGTGHAPAASRPRTVA
GGAVTSDPRLLTKILIGINLAVFIAVQADSSLLDHLVLYGAWPPKPFAPTSGVAGGEWYR
FVTSMFAHQEYWHIGFNMLSLWWIGGPLEAALGRARYLAVYFVSGLAGGALTYLLTSPQT
ASLGASGAIFGLFGATAVLMRRLNYDMRPVIALLVINLIFTFGVGNIAWQAHIGGLVAGV
VTGYAMVHAPREKRALVQYGTCAVVLVLAVALALVRTAQLT
Download sequence
Identical sequences H2K3T1
gi|386841294|ref|YP_006246352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]