SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386842272|ref|YP_006247330.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842272|ref|YP_006247330.1|
Domain Number 1 Region: 67-237
Classification Level Classification E-value
Superfamily TPR-like 1.3e-36
Family BTAD-like 0.00044
Further Details:      
 
Domain Number 2 Region: 240-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.29e-29
Family Nitrogenase iron protein-like 0.075
Further Details:      
 
Domain Number 3 Region: 671-881
Classification Level Classification E-value
Superfamily TPR-like 4.05e-25
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 
Domain Number 4 Region: 850-959
Classification Level Classification E-value
Superfamily TPR-like 0.000000000026
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Domain Number 5 Region: 1-61
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000125
Family PhoB-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386842272|ref|YP_006247330.1|
Sequence length 971
Comment AfsR-like transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLATLLLEPGRLVPVSRLVEAAWEEEPPATASHQVRKAVADLRRRIPGGSQVVLTDGPGY
RVAVLEDQLDLTEFTVLVRRARAAAEQDHAAQAVEALRTALELWRGPVLSDVAGPVISAA
AAALDERRLAAAEQLFELCLGLGQAAELVADLRDLTAKYPLRENLRRQLMLALYRSSRQA
EALEEYARVRDLLVEELGIDPGQQLTQVYEGILRESPDLAAPEPPVSPAPAAPAPAQAPC
TLPCDLADFSGRDREQRELLDCAQRSVTSAPGIVAIDGMGGCGKTALAVRVAHRLADDYP
DGRLYINLRGYTPGEQPVTSAAALATLLRALGVPGDQIPDDLEGRTAAWRAALTGRRLLL
LLDNAVDAADVRLLMPPSPGCLVLVTSRSRLLDLDGAHWTSLDVMSGDDSVLLVSKTLGA
ERVAAEPEASAELARLCGHLPLALRIATARLRNRPRWTVGYLVDRLCDETRRLDELSLGE
RSVAATLRLSYQTMAAESRVAFRLLALHPGSDIDVHSAAALLGTDTRDAEDILEHMLDVH
LLQQPDVGLYAFHDLVRSFALSLRGPATEEEDHAAVGRLLAYYLTATERACDVLFPGRRR
RPTGLPATGAELPDLGDAHRALAWFTREHTALSGAVALARTHGHDRHAVWLTRDVVFYLN
ARGHISEFRDLSRSAVEVARRLGDLVLLAVSLSNLGVACWKLGRFEEGVEVAREALEVAT
ELGDRDTEAHSESTLGLLNSVLGRFDEALPHLVRAVDLGRELGNARSESESLTILSTLYE
QWGRYPEAAEAARRAVELDRRLGNRENEIVSVTDLALALLGLEEYAEAQRCLERARRIGD
QTHDPGNVGVLLALSADVQHRLGDTADAARLADQALELVRSSVVPIRQVKTENILGRLCT
RQGDPAKALHLHTSALKTASGIGYRIEEAHALAGLARACEALGDHAAARQHAGAAAGLFD
TMGVPEIGRSR
Download sequence
Identical sequences H2JZ07
WP_014674751.1.21199 WP_014674751.1.57224 gi|386842272|ref|YP_006247330.1| gi|474984482|ref|YP_007694948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]