SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386842539|ref|YP_006247597.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842539|ref|YP_006247597.1|
Domain Number 1 Region: 233-502,562-604
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.2e-84
Family Type II chitinase 0.00000342
Further Details:      
 
Domain Number 2 Region: 31-132
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6e-30
Family Cellulose-binding domain family II 0.00032
Further Details:      
 
Domain Number 3 Region: 141-221
Classification Level Classification E-value
Superfamily Fibronectin type III 9.68e-17
Family Fibronectin type III 0.00042
Further Details:      
 
Domain Number 4 Region: 504-563
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000664
Family Chitinase insertion domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386842539|ref|YP_006247597.1|
Sequence length 606
Comment chitinase C [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MRFRHRAAAGFATLLLPLAGLVGLAGPAQAATNATAVFAKTSDWGTGFGGQWTIKNTGSS
SISSWTVEWDFPSGTSVTSAWDADVTGSGTHWTAKNKSYNGTLAPGASVSFGFNGAGSGS
PSNCKLNGDSCDGTTVPGDAAPSAPGTPTASSVTDTSVKLSWSAATDDKGVKNYDVLRDG
SKVATVTTTSYTDTGLTAGTDYSYTVQARDTADQTGPVSGAVKVHTTGGGTTPPPTGDKV
KLGYFTEWGIYGRNYNVKNLVTSGSAAKITHINYAFGNVTGGKCAIGDSYADYDKAFTAD
QSVSGVADTWDQPLRGNFNQLRQLKAKYPNIKVLWSFGGWTWSGGFADAAKNPAAFAQSC
YDLVEDPRWADVFDGIDIDWEYPNACGLTCDTSGAAAFKNVMSALRAKFGSNNLVTAATT
ADGSAGGKIEAADYAGAAQYVDWYNVMTYDFFGAWDAKGPTAPHSPLTSYDGIPKAGFTT
ADAMAKFKAIGVPAKKLLIGIGFYGRGWTGVTQDAPGGTATGPATGTYEQGIEDYKVLKT
SCPATGTVAGTAYAHCGSNWWSYDTPATIASKMAWAKNQGLGGAFFWEFSGDTSNGELVN
AISSNL
Download sequence
Identical sequences A0A101Q5W1 H2K5P1
gi|386842539|ref|YP_006247597.1| WP_014675017.1.21199 WP_014675017.1.28171 WP_014675017.1.57224 gi|474984749|ref|YP_007695215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]