SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386842588|ref|YP_006247646.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842588|ref|YP_006247646.1|
Domain Number 1 Region: 428-620
Classification Level Classification E-value
Superfamily TPR-like 1.26e-28
Family Tetratricopeptide repeat (TPR) 0.0061
Further Details:      
 
Domain Number 2 Region: 5-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.61e-25
Family Gluconate kinase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386842588|ref|YP_006247646.1|
Sequence length 646
Comment AfsR-like regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPPVLISALTGMGGIGKTALALEAAHRACAAGWFPGGALFVDLRGYDDDPVTADQAVLAL
LDALGVRGPDLPATATGQYDTYRALLAARRERTLLILDNVSDPGQFLPLLPGTDRHRVLV
TSRERPDALPVRRIDLDPLAAAESVALVTRALLDADERDDRPAREPEALRELADLCGHLP
LALQIAAAMLRRRHPRAIASLVRDIRKTTDRTPLLDGGPVGTDQYGRSLVLRPVLETSYR
RLPSGQARLLRLLALAPGTETATWTVAALTGLGWEAALSLLEDLAATCLVTRVRGTAGDA
DPRWLVHDLVRAFAAGVVAARPDLREEGEEARERALGFYVLCAHMADARLRWLPGEPEPE
LFADRARALAWLDRERTALVAAVRWAAEDRYARLSVQLAEYLAEYLEWRRYFDDWITVAS
AARDAAHRTGDRRAEGVGWDYLGLALRHAGRTDEAIDAHLRALGLSRAEGHRGGEAIQWG
HLANALLVAGRPEEAIDAHLRARTLHQTHGHVQAEADEWNNLALSLHAVGRTEEAIDAHV
RARDLYLALGDRHGAGIAWNNLARTWEAAGLTAQAIGAYGNALEVQREFGDWFGAGMTLG
NLAGVHAATGDPVRARATFLAAADAYTRADAPAEAARCQSRADTLT
Download sequence
Identical sequences H2K5U0
gi|474984797|ref|YP_007695263.1| gi|386842588|ref|YP_006247646.1| WP_014675066.1.21199 WP_014675066.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]