SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386843118|ref|YP_006248176.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386843118|ref|YP_006248176.1|
Domain Number 1 Region: 98-208
Classification Level Classification E-value
Superfamily TPR-like 0.000000000948
Family BTAD-like 0.029
Further Details:      
 
Weak hits

Sequence:  gi|386843118|ref|YP_006248176.1|
Domain Number - Region: 3-72
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000105
Family PhoB-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386843118|ref|YP_006248176.1|
Sequence length 443
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MNGAAVRLTPLTARLLLRLVAADGEAVTARRLYEDVWQPTVELPHQDLRNRNEVQKRILE
LRRAFDRAGPGHGARIVRTGRLPTARGAESTYRLDLADDELDSAAFTRLVGDALRAAPAS
AVRLLTDALRLWRGRPLTEVRDEEFARAPVRRLTQLRETALRELIAGHTALGRYDLALPV
AEQTARERPDDPEAAAALARLNARLRERHGDELLRHTLRGLRVDVVVVRGDLFDQEDANL
VVGFSDTFDTSTDDIVISRESVQGQLVDRLFEGRHRLLDDHLRRGLREVTPLATESVRAK
PRGRRTRYPIGTAVPVPVGNRRVFALAYSRLGNDLRARSAPADLRLSLERLWPSVALHGL
FRPVAIPLIGAGLSRIVELDHTQLLSLIVETFTESLRQDPAVCPELRIVVRDEELGRTDL
SAAEAFLRDADERSPVLPPTGTL
Download sequence
Identical sequences H2K448
gi|386843118|ref|YP_006248176.1| WP_014675588.1.21199 WP_014675588.1.57224 gi|474985326|ref|YP_007695792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]