SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386843421|ref|YP_006248479.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386843421|ref|YP_006248479.1|
Domain Number 1 Region: 83-247
Classification Level Classification E-value
Superfamily TPR-like 5.69e-28
Family BTAD-like 0.00034
Further Details:      
 
Domain Number 2 Region: 299-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.11e-20
Family RecA protein-like (ATPase-domain) 0.045
Further Details:      
 
Domain Number 3 Region: 795-968
Classification Level Classification E-value
Superfamily TPR-like 0.000000000303
Family Tetratricopeptide repeat (TPR) 0.068
Further Details:      
 
Domain Number 4 Region: 6-78
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000454
Family PhoB-like 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|386843421|ref|YP_006248479.1|
Domain Number - Region: 573-639
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0141
Family MarR-like transcriptional regulators 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386843421|ref|YP_006248479.1|
Sequence length 1135
Comment AfsR-like transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MWDDEGEPLKVPETKVRALLADLLAHDGGPVSADRLVHDLWGDHLPGNPAGALQAKVSQL
RRVVGRERLVRQPPGYRLRLGPADGVDTERFGRLVAQARPVADPRVRATLLTEALGLWRG
PAYADFADEEFTRAARECLGEQRLAVLEERAEARLAAGDHLLLAGELAALVTEHPLRERL
RAVQMRALYRAGHQGEALASYEDLRTRLADELGACPGPALSALHRAMLRQDPSLTTDPAT
WAGATTPSPELTVPSPRLTASSPHGTAPHPVPAGPVPPYPASSSPPEIPPATAATPATPT
NLPHPLTPLIGRDQALADLSPLLARQRLVTLTGPGGVGKTRLAVAVAQGVASGGVPDGVW
FVEFAGLRGATPDDLAGIVAATLGIRDDAPSAPPATGTVAASPVHRLAAALRDRRTLLVL
DNCEHVVASAAELVALLLRGAPGLRVLTTGQEPLALAGETVFLVEPLPTPDAVRLFTERA
AACAPGFRLGTGEDDGTGEDQGADPALVAEICRRLDGIPLALELAASRVRALGVRELAAR
LDDRFRVLTSGQRGAPARQQTLRAMIDWSWELLSVPERLVLSRLAVHSDGCALDAAEAVC
AGEGVPGGAVLDLVTRLVEKSLVVVTAGPAGPRYRLLESVAAYAVERLRDTDDETAVRER
HLRHYLTLAERAEQRLRGPRQRDWLARLDTEAGNLRAALDEAVRRAAAGRSAEAVRLATA
LSWWWLLRGRLTEGRRGLAAVLAATAGDPDPELALLHSAFVLLTGERTVTPAADAVPDPV
RRARALWLNAYGGFSVGDLDGSRALNARALAQFEAVDERWGTAAALGLRAALALVRGDLD
AVARDGRRSRALFRELGDGWGELQTVSPLAVLAEIKGEYTRAAHRQREGLRIARELCLQA
EVSARLSGLGRLALLARDFDRARRLHEQARRIAVEQGYKYGEIHADMGLALGARRSGDLD
AAEAHLRRIRAAHADVSSPAGDHLRHAELGFLAELRGDAARSAAHHLRGLRIARSLDEPR
ALALSLEGLAGTAALCGHRSGATCAALLLGAAHAARRSVGAPLPPAERGDVDRVTAAARA
VLGPRAFTEAFEGGARLTPAEAVRHARTTLAGPADRAARARCAPTVPRAPGPAQP
Download sequence
Identical sequences H2JKR5
gi|474985629|ref|YP_007696095.1| gi|386843421|ref|YP_006248479.1| WP_014675891.1.21199 WP_014675891.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]