SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386843684|ref|YP_006248742.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386843684|ref|YP_006248742.1|
Domain Number 1 Region: 610-716
Classification Level Classification E-value
Superfamily TPR-like 0.000000000949
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 2 Region: 18-104,149-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000125
Family RecA protein-like (ATPase-domain) 0.062
Further Details:      
 
Weak hits

Sequence:  gi|386843684|ref|YP_006248742.1|
Domain Number - Region: 404-509
Classification Level Classification E-value
Superfamily TPR-like 0.000524
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386843684|ref|YP_006248742.1|
Sequence length 854
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MTQGRPSAAGSAPLWERDAELATVAQALDVLCADQSSAGSLLVIRGEAGLGKTALLAEIR
RIAERRGCAVWSARGAETLRSVPFHVVRQLLQPALLSLLPEEAREYLGDWYDIAGPALGI
AEPRAGKADPQYVCDGLVAAVRRLSSRQWPLVLLVDDAHWADQETLRWLAAFAERLEDLS
VLVVVARRPGEVSGDGARLLDAVAAAGRPVHNLSALTPDATAGLTRATVGRHADDAFCRE
VWAVTGGNPYDTVELLAKVRDSELPPVEAQAGELRALNRAARDGGLVDRLKGLGLEATRF
AWAAAILGTGITVDMVAQLATMNDELARTCAELLCDARILTAPEPPAGTHRTDGELEFVH
PLIATAVYNSIPAGVCTAMHGVAAQMITERGRGAAEAARHLLKVHPDDDEELVEQLREAA
REHLAVGAPDAARRCLERALAEPPLPEVHAHVLYELGCATLLTNPAVTIDHLQSALAMPG
LDDDRVDAVVRLSQALLHNDQLEEAVRTVEAEAARHEAGPVRMRLQAFQFMWEGIHGETV
SPARSRRLAELASTCAGRDNAERVLLVLRAFDAMTHGESADEVIALCDRALVNGRLAPGL
GWTDTEWGMELLMMLGSAYTYADRLDRAESLFAEARRVYTTAGWHGGHLSLANAFLGLAY
RRQGRLRDAESTLREALVLAERVGRRLPLYWSAVCGLVDILLARGRVKDAWSVAERYGFA
PPYPSTIVLPDIRSVRGRLLLAVGRTEDGIDELEDAEKTAASRGGHNPVLAPWSVDLAKA
LAAQDPDRAAQLAADARRQAERFGTDTAIGESLRCAAARSAAELGRGLDLARSCGAEHLV
ARAREALETGRGLR
Download sequence
Identical sequences H2JQL5
WP_014676154.1.21199 gi|386843684|ref|YP_006248742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]