SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386844068|ref|YP_006249126.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386844068|ref|YP_006249126.1|
Domain Number 1 Region: 254-394
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 2.22e-32
Family Oxidoreductase molybdopterin-binding domain 0.00071
Further Details:      
 
Weak hits

Sequence:  gi|386844068|ref|YP_006249126.1|
Domain Number - Region: 8-154
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0188
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386844068|ref|YP_006249126.1|
Sequence length 395
Comment hypothetical protein SHJG_7987 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLGIVLLVGITVLFVTGLVSYAAYNPDLARVNDQTPDKGILGFYLFAWPTNPYWLYRVTQ
GLHVTLGITLIPVLLAKLWSVVPRLFALPPARSLAHALERISLLLLVGGGLFEFTTGVLN
VQLDYVFPGSFYPLHFYGAWVFFAAFVAHAALKLPTAVRSLRRRREERGEPVPRAPEPGE
LVSPRPLPPTVSRRGALWFVGGASLLLLVTTAGQSIGGALRRTALLAPHGGADPGGGPNG
FQINKTAAYAGIDAAETGEEAWRLVVTGRTGTVRLSRAQLLRLPLHSSALPIACVEGWST
EDQWWRGVRLRDLAALVGYDGDPPDLFVESLQRRGAFRRAALRANQVADPRSLLALYVNG
EALSPDHGHPARIIVPAAPGVLNTKWVARLTFGDL
Download sequence
Identical sequences A0A101QJH1 H2JXS4
gi|474986279|ref|YP_007696745.1| gi|386844068|ref|YP_006249126.1| WP_014676536.1.28171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]