SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386844911|ref|YP_006249969.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386844911|ref|YP_006249969.1|
Domain Number 1 Region: 740-803
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000293
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|386844911|ref|YP_006249969.1|
Domain Number - Region: 433-488,576-603,687-717
Classification Level Classification E-value
Superfamily TPR-like 0.000379
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386844911|ref|YP_006249969.1|
Sequence length 817
Comment LuxR family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLRELVETVCRQARRTPVAICLDDAGHLDPWSLHWLSGLYSAASDLPLAIALTGGDIAAA
DQDPWPPALAADAEHIALSGLDPEEVGAFAAAYRNVPLDAPTAQLCHELTGGNPALLLSL
LACHTGTAPTADALRDTAASAVLPGADRWLAGLGGAALGLARAVAVLGPQAEITQCAELA
GLSVREALPLIDELVARSLFANRTPLSFRHPLLAGMVISRVPAGTRAALHLTAAGILRDG
HFGATHVARQLVAAGPLGLAWTVRPLRIAANQLEREGRHEEAAGHLRGMLRERLRPRVRS
SVQCQLAALDGFAAPDSAVRRLDAARREADDPRCATDYAVALGTLLAECGRPEDAVAVLD
DTAERLGPQAAAQRWRLRLRKALLCLGGPVPSVLPADLPDSLAAQAPSDDEARRELSALR
AVHALRDGTDRDAAVGHARGALTGSEDPGRLLWHGCEVLIRADELAEAWSYCSRARLLDQ
SRPGTWGDVGVGLLRALVLYARGSLTAADAALTPLADLLRPAAEAARLPATLTVAVLAEV
RAQTGATDAALALLADCGLDGELPARQDTVAVLGARAAVWEQAGDTARALEDLYAAGRLL
ADSRVRNPAVLPWRSRAARLLASRGDLTEASGLAAAEWEDARRWGTPRAVGTAQHALALT
ETGGRRLRRLATAVETLAHSPARLELAYARRDLGAALSEAGRADAARTEFRAALSLAKSC
GAQPLVRRVLADRECLWPVVDDDRGSPALSGLTPQEQRILGLARAGHTNKAIAGKLFVTV
RTVEFHLSGAYRKLGISGRDQLADVIPAPLGTGGGRA
Download sequence
Identical sequences H2JPB6
gi|386844911|ref|YP_006249969.1| gi|474987119|ref|YP_007697585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]