SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386836235|ref|YP_006241293.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836235|ref|YP_006241293.1|
Domain Number 1 Region: 389-661
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.19e-26
Family Extended AAA-ATPase domain 0.082
Further Details:      
 
Domain Number 2 Region: 192-339
Classification Level Classification E-value
Superfamily TPR-like 4.93e-16
Family BTAD-like 0.0014
Further Details:      
 
Domain Number 3 Region: 96-188
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000128
Family PhoB-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386836235|ref|YP_006241293.1|
Sequence length 766
Comment regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MALNCATLSLISSTALSGTHGEYGFQGNRDSAGNARSTTGRTIHQSARLRVLYRPDTPVL
CRVQPTRSSPSHERALLMPRMEAALSRRGTEVSTSFSVLGPLRAWDGTVELSLGPPKQRG
LLALLLARAGQPVTTHEIVDVLWGQDPPDTAVNVIQRHVGALRRLLEPDLPAGISSRWLV
RGSGGYRLDVGVDNLDLLQFRSLRQDAEQEAQKGQSARAAGLLMRALELWRGPVATGIAP
VARAHPIFTTVDREQIAAVDRAAALAAQAGPALSQGILPVLHDTAALHPLDETLQARLVT
LLAITGRQAEAQKVYHSVRLRLAQDLGVEPGAELRAAWRMTSVATTDAVGYRGSTQAPSP
SASRIAAPPTQPTPQGASTVSRPNASITRPAQLPLSSAAFIGRKTELTFLEQLLSDKNGQ
AGPAVVSTIVGTAGVGKTALSVHFAHRAADLFPDGQLYADLRGFHPQTAMTTGETVQRFL
DALGVPANRIPSSLDGQTALYRSLLADRRLLIVLDNVSNSEHVRPLLPGFSPSLVIVTSR
NRLSGLVAETGAHCTTLGLLSTDDAHAFLSRRLGAKRVLREAGAANEIIKRCARLPLALA
IVSARAALNPSFSLTAIADELDDQWGCLDALTAEEPLIDTRSSFSWSYRKLSPDAARLFR
LLSLQPALGCTATTAATLAGLPVTHTKMLLSELNNNHILAEAAPGCYTSHELLRRYAKEL
CNLHTAPAEVRAARDRLLKLRQQNFATAPTRSSHGDGVGWRSADSA
Download sequence
Identical sequences H2K4N4
WP_014668783.1.21199 gi|386836235|ref|YP_006241293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]