SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386839835|ref|YP_006244893.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386839835|ref|YP_006244893.1|
Domain Number 1 Region: 95-253
Classification Level Classification E-value
Superfamily TPR-like 3.19e-31
Family BTAD-like 0.00065
Further Details:      
 
Domain Number 2 Region: 252-526
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.65e-18
Family RecA protein-like (ATPase-domain) 0.061
Further Details:      
 
Domain Number 3 Region: 15-91
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000156
Family PhoB-like 0.002
Further Details:      
 
Domain Number 4 Region: 794-940
Classification Level Classification E-value
Superfamily TPR-like 0.000000000624
Family CT2138-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386839835|ref|YP_006244893.1|
Sequence length 1085
Comment multi-domain regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MDPVRYRLLGTTQAIRPDGTAVPVGGARLRALLSVLALRAGRTVPAGVLVDEVWGADPPA
DATGALQALVGRLRRALGAGAVVSADGGYRLTAAPDDVDLGRFDRLTGDGLAALADGDPA
KAAAVLDDALALWRGPALADLPDRTAEAVRWETRRLDALRARHTAALALGEAERALPELT
ALCDSHPLDEPLQALRLRALRDTGRPAQALAAYEDVRRLLADRLGSDPGPELRVLHAELL
REEPAERPAVARLGNLPARLTSFVGREADLRAIGADLSTARLVTLLGPGGAGKTRLSQEA
AEAVRHTVRDGVWLAELAPVDAPDAVPQAVLTAIGARETVLHGAGVDGMRAVSDRHGDPV
ERLVEHCARRRMLIILDNCEHVVDAAARLTEHLLARCPELTVLATSREPLGVPGELVRPV
EPLPEPVALRLLADRGAAARPGFRVEDDPEACAEICRRLDGLPLAIELAAARLRMLTPRQ
IADRLDDRFRLLTSGSRTVLPRQQTLRAVVDWSWDLLDAGERDVLARLSVFAGGCDLAAA
EAVCGPAALDALGSLVDKSLVVAAPAADGGMRYRLLETVAEYAAERLAETGHRAEAERAH
LAYYRELARTTDPLLRGSEQRAAIDRFQLEYENLRTAFRHAIAERDEQEGLCLVLSLFWF
WQMRDQRIEIRTWCREVMALGPDPFTEPVRRAEPVWQRCTDAPPPYTGELLAEARRGVHL
AHLACMDTEIDLWQTPEAQAKLRVVAQVYEPGLPQTCRPPGMLWFFAGLLTGGADVVRTI
VDANVRTCRETPGYEWELAGALHLRANLLANRASWAGDATRDADESLEIYHRLGDAWGIT
EALSARGEANERKGAHREAAADYQAAIEHAERLGAHAQVAVLRARLGSVLVQAGESERGE
RMLRDVTADRHGAHNEAVPFARLFLAGWLSLTGRTAEAREQLRRTREEVTIARFVVFDAM
ITSQEAWVDAVDERTEEALTRVRRAVRLGANPLSEALNPHLNSICLTIAAMALARADGGD
RAADAARCLGAADALLPPGHIPSDVERRCHALTEARIREALDPLSYEAAYAEGGGLSLAE
ATALF
Download sequence
Identical sequences H2K022
WP_014672352.1.21199 WP_014672352.1.57224 gi|386839835|ref|YP_006244893.1| gi|474982046|ref|YP_007692512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]