SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386839899|ref|YP_006244957.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386839899|ref|YP_006244957.1|
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily TPR-like 0.00000000032
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386839899|ref|YP_006244957.1|
Sequence length 287
Comment hypothetical protein SHJG_3812 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MDKSEAKQLIVRAYDAWDAEDWLTAAGLFERVLAHYPDTSRSPVWWYDAALAHKFLRNWG
KAYELGREAAARAPRGEGDPAYWNLGIAATIQRDWATARDAWEGFGIQLPPGEGEIDGRF
GPACVRLDTDGKREVVWIDRLCPTRGRVMNVPVTGGRRFGEVVVHDGEPKGHRVVEGREY
PVFEELLLFQPSELTTLTATVNAGEAADLDALIELFDRHGYGAEPASGFEVLCACCSEGT
HEQERKTHGGAQRVSFGAPEEEARRLLGQWAAQTPIGRSWSGLTVAG
Download sequence
Identical sequences H2K1L1
WP_014672416.1.21199 WP_014672416.1.57224 gi|474982110|ref|YP_007692576.1| gi|386839899|ref|YP_006244957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]