SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386841699|ref|YP_006246757.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386841699|ref|YP_006246757.1|
Domain Number 1 Region: 68-275
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.4e-18
Family G proteins 0.075
Further Details:      
 
Domain Number 2 Region: 566-682
Classification Level Classification E-value
Superfamily TPR-like 3.21e-17
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Domain Number 3 Region: 778-893
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000596
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 4 Region: 692-809
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000363
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 5 Region: 1282-1433
Classification Level Classification E-value
Superfamily TPR-like 0.000000000047
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 
Domain Number 6 Region: 1036-1144
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000607
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Domain Number 7 Region: 1155-1307
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000633
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 
Domain Number 8 Region: 1450-1568
Classification Level Classification E-value
Superfamily TPR-like 0.000000000106
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Domain Number 9 Region: 905-1021
Classification Level Classification E-value
Superfamily TPR-like 0.000000000966
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 
Weak hits

Sequence:  gi|386841699|ref|YP_006246757.1|
Domain Number - Region: 494-598
Classification Level Classification E-value
Superfamily TPR-like 0.000311
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number - Region: 1616-1708
Classification Level Classification E-value
Superfamily TPR-like 0.0209
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386841699|ref|YP_006246757.1|
Sequence length 1823
Comment hypothetical protein SHJG_5617 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MTAMIAAQGSLTAENLLGQADGATALWRVKAIEAGGNPHLEERAVVLPAAARAAITWLSA
PEGLHNLPAAGDGLIGRTDALRGLRESLTSGAGVICQAAAVHGLGGVGKTTLALHYAHAH
LDYYSLVWWITAESEEQIASALADLAVRVYPDWALGAGARERTEWAVRWLQAHPGWLVVY
DNVNEPLHVNPYLSRLFGRGHQLVTSRRRAGWRAGTHLVSLDVLSPHLAVDLLCTVAFPD
RRPTAAERRQAGLLASDLGYLPLALAQAAAYVRETGTSFASYRSQLVAAAGDALETTAPS
EGLDRAITQIWLTSSRAIGERCPVAVDLLMALAWYAPEALPMRVLLSLADSEAEARTAVE
MLADYNLVSVGGDSVSLHRLMQKTLRAAASVRAADIRGRAERALARALPDTSAMDGEAER
GVWQRWLPHVQALAKTGPSSTPRHEVTEMYRRAADELVAREQHVLAIPLVERVVENQLRL
PAADGSAILADQDRLAELHAKAGDPARAVRLCQEAFRDRLRLSGGDAASTLAGRHRLAYA
YQKAGDVLAAVREFEAVVADRRRVLGDDHPDTLTSRNDLAYARQMAGRHRRAVEEFEAVV
ADRRRVLGDDHPDTLTSRNNLAYAHLRAGDHRLALRLYEQAVADRERVLGADHPDTLTSR
GWLASAHEAAGDQQQAVSLYTALRAQRGRIQGEDHPETLKTRQSLGYALMEAKGPAAALP
EFASLAEDSERCQGPDHPDTLDYREDIAYAHRVLADYAQALAEYEHLVEDYARVRGPEHP
ETLSTRNALAYARQLAGDHPRAIVELQGLLDDRTRVQGEDHLATLAAAENLAYAYQAASE
YDQAIALYERVLRDRTRIMGDDHPRVLDTRWSLARCRQLAGSPERAVSELRALVADQVRV
LGPGHREVYLTRRALGGAHSAAEDHATAISLYRELLEEMERALGADHQDVLNTRGWLAEA
YRLAGEYYRSISAWEALVADRRRIQGADHPAVLEARHQLAWSLRSACEYRRAIEIHEDVL
RDRVRLHGADSRITLIARNEVALGHKYAGHHQRAIDEFASLLADYRRVFGEDHPDTLVVC
ANLAHAYAAAERHGEARSLFEDVISRWTRLKGEDHPQTLDARRSLAQSYGEAEEHRLALA
EFEAIWTARTRLNGADHPDALDALDDLAAACRDAGEYRRAALLSQRIVDDWGRLRHPDHP
KTLLARRWLALAHQLAEEHSRAVAESEALVADRERVQGPLHLATIVAGENLANACRSAGE
HERAVRVREQWLARRLQVQEHDHPQVLTSRHWLARTRLDADDFAGAVRDAVAVVADLERT
LGASHLDTLNARLSLALVRQRSGETAEAIRLSERLVADCVRFLGPDHPLTFTARGRLAFA
HRAAGHFAQSVRLQRERLADLLRVRDADHPSVLSARDALTRVLRLRGAYKEAVGELDSLV
ADGFRLHSPLHPSTVEWRVDLAFACRDAGDHWRAIAVMEELLRDCRTALAEDHPTTLHAR
ARLALLATEFGPPRRAVARFERLVEDAARVYGSRHRVPLQLRDHLAYALLQADDPEGALA
VQRASLADRARLLEHSGFPGTPEGIAEAHRQAADGSADDRARSVVMVCLERADDGYPTWT
ESLARAMAEAGDTEGAERLLREVHAGREHVLGPDAPETLDSLTMLAFVRAEAGQHDAEPS
HDELLTRWERVLGPDHPRLEALRAQLARLRPAWLPRMTLLDDPGVGTEAAIEVWLERSGG
TAAPELPPLLLVAGARTAAVIEPAAQEYTAGDEPARFGFTAKEPGAHRVRFTVYDQEYGF
VLQDLEATVHVPAPPVPSSPGRD
Download sequence
Identical sequences H2JNT1
WP_014674197.1.21199 WP_014674197.1.57224 gi|474983909|ref|YP_007694375.1| gi|386841699|ref|YP_006246757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]