SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386842119|ref|YP_006247177.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842119|ref|YP_006247177.1|
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily ITPase-like 1.5e-52
Family Maf-like 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386842119|ref|YP_006247177.1|
Sequence length 196
Comment septum formation protein [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLASQSPARLALLRQAGLAPEVIVSGVDEDAVTAPTPAELALALAEAKASVVAARPEVQG
ALVIGCDSVLELDGQALGKPADAEEATARWKSMRGRAGVLQTGHCVWDTEAKRYVSATAS
TVVRFGEPSDEEIAAYVASGEPLHVAGAFTLDGRSAPFIEGIDGDHGNVIGISLPLLRRL
LAELGVGITELWAPER
Download sequence
Identical sequences A0A0S2P5P7 A0A101QIV3 H2JW15
gi|474984330|ref|YP_007694796.1| gi|386842119|ref|YP_006247177.1| WP_014674598.1.28171 WP_014674598.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]