SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386842467|ref|YP_006247525.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842467|ref|YP_006247525.1|
Domain Number 1 Region: 814-838,884-967,1029-1095
Classification Level Classification E-value
Superfamily TPR-like 0.00000316
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386842467|ref|YP_006247525.1|
Sequence length 1157
Comment hypothetical protein SHJG_6385 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPGMRLDELIGKLRQGGLQPTAEDVADALWLARRLATGAPGDPDDTSGTGPDGPPGSTGS
SGSGGAAGSSGPSGTGGASGPGTQDVPPDGPGSPQPLRADAPAPAVPLHTPSSAPYARSD
GDPAAFPVRAPAAGALPGLLGLQKALRALGRYRTASAHGRDERIDEAATADRAAASGILL
PVTRPGRDRRCDVQLLMDTGPAMAVWGEMVEELRQACQQSGAFASVRVHQLYADDRGTPL
VGTTVGPGRRIRLRPADELHDPSGRRLTFVISDCVGPLWQDGTAQRLLHGWPRTAPLAVV
QPLPPRLWGRTALPAEPGLLVRTGESGGRLDFLPEDEPWEEAEEPPPGARPVPVLQPTPE
AFAAFARLLAGTGPTREHAWAGFAHPAAAPGAVPAAAPARSDEELLRAFRAGASPGALRL
AVYLAAAPLTLPVMRLVQRAMLPDTGPMELAEVLLGGLLRQLPGTEKQPCFAYSPRMQDL
LLSSLDQDTAGLVLKHCSAYVERHFGKGTRNFAALAAARLADHDPDAGTGRSAEDGAARD
GGSVEAELFARIPARVLRFYLPDLVTPDPLTEAERLLDRWRQLADPEMLRRAREQARVAT
AGTGADGPGPVARARLVLGRVLRAEAGTAGARAEGRRAGLLREAAAELAAAYGVAPADSR
ERAEAALELASCRRELWQLTAEGDHLTEALDALDGEVPPWPRITAVARDWRPGLGEAGGA
ILGDGSPGDGGPADGASGGSGSGDAGDGSADRGVAHPGAGDDGSTYGRTGDDGSGHDLGG
TDTVVPAAADPEPSPASRDGVPWEVTAHRARLLLRGRVLLDLRRPGAAEPVLREACAVLA
RERVPDAVRGPALLDLARALHRADVEDAELRRALGEALEAAGDDPDLLLPCLAALAAFHD
AAGETGEADAAYERAVLLAPADGPLRVQLLTAWGESLLRRASAGDGAGVVDRAEYVLREA
LKSLPARSAHRGRLQGLVGSALAQRFRHVGFLPDLFESRHLLGQAVRAATDAAVRAEVWL
QLGRVRLEGWYHAGAPVLMEALQAYENAEREAEAAHGGDPGSVTAARARHGCGAVLALMG
RPGAARGAFRAALEQWQRLVGALREVDWGDVELTRRAERQPPPPDARSLPEPDWRETAPP
WWPWSQEWADARELDRS
Download sequence
Identical sequences H2K3V6
WP_014674945.1.21199 WP_014674945.1.57224 gi|386842467|ref|YP_006247525.1| gi|474984677|ref|YP_007695143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]