SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556581986|ref|YP_008749967.1| from Mycobacterium kansasii ATCC 12478

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556581986|ref|YP_008749967.1|
Domain Number 1 Region: 112-245
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.15e-31
Family Reductases 0.084
Further Details:      
 
Domain Number 2 Region: 238-355
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-25
Family 2Fe-2S ferredoxin-related 0.019
Further Details:      
 
Domain Number 3 Region: 14-121
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.35e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|556581986|ref|YP_008749967.1|
Sequence length 361
Comment ferredoxin [Mycobacterium kansasii ATCC 12478]
Sequence
MTEAIPDEPLGSHVLELQLAEVVVETDDARSLVFAVPDGPDDPQIPAERLRYAPGQFLTL
RVPSDRTGSVARCYSLCSSPFTDDALTVTVKRTADGYASNWLCDHAHPGMRIHVLAPSGT
FVPKTLDDDFLLLAAGSGITPIMSICKSALAQGCGQVTLVYANRDDRSVIFGDALRELTA
KYPDRLTVVHWLESLQGLPSATALANLAAPCTERQVFICGPGPFMDAAREALVTLKVPAP
QVHIEVFKSLDSDPFAAVKLADVGGDDTAPPATAVVELDGETHTVSWPRNAKLLDVLLAA
GLDAPFSCREGHCGACACTLRGGKVSMEVNDVLEQQDLDDGLILACQSHPESDSVEVTYD
E
Download sequence
Identical sequences A0A1V3X1L9 U5WPQ8 X7XTP5 X7ZD23
WP_023368469.1.16017 WP_023368469.1.23645 WP_023368469.1.29073 WP_023368469.1.34812 WP_023368469.1.43690 WP_023368469.1.43814 WP_023368469.1.6362 WP_023368469.1.64499 WP_023368469.1.72138 WP_023368469.1.74408 WP_023368469.1.75720 WP_023368469.1.82574 WP_023368469.1.82622 WP_023368469.1.8461 WP_023368469.1.98687 gi|556581986|ref|YP_008749967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]