SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556583571|ref|YP_008751717.1| from Mycobacterium kansasii ATCC 12478

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556583571|ref|YP_008751717.1|
Domain Number 1 Region: 1-197
Classification Level Classification E-value
Superfamily ITPase-like 2.62e-47
Family Maf-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556583571|ref|YP_008751717.1|
Sequence length 213
Comment septum formation protein Maf [Mycobacterium kansasii ATCC 12478]
Sequence
MTRLVLGSASPGRLKVLRQAGVDPLVVASGVDEDALICGLRPEASPDEVVGALARAKAEH
VAAAVHPSLASDCVVVGCDSMLQLDGRLCGKPQSIASARQQWQSMAGRAGQLYTGHCVIR
LQDNRIIHNVGETAITTVYFGSPSPGDLESYLASGESLRVAGGFTLDGLGGWFVDRIDGD
PSNVIGLSLPLLRSLLPRVGLSVATLWARDAGD
Download sequence
Identical sequences A0A1V3XXJ9 U5WU98 X7Y7D0
gi|556583571|ref|YP_008751717.1| WP_023371469.1.16017 WP_023371469.1.23645 WP_023371469.1.29073 WP_023371469.1.34812 WP_023371469.1.43814 WP_023371469.1.6362 WP_023371469.1.64499 WP_023371469.1.72138 WP_023371469.1.74408 WP_023371469.1.75720 WP_023371469.1.82574 WP_023371469.1.82622 WP_023371469.1.8461 WP_023371469.1.98687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]