SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556583648|ref|YP_008751809.1| from Mycobacterium kansasii ATCC 12478

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556583648|ref|YP_008751809.1|
Domain Number 1 Region: 153-281
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.88e-27
Family Reductases 0.053
Further Details:      
 
Domain Number 2 Region: 39-166
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.71e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 281-381
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.34e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556583648|ref|YP_008751809.1|
Sequence length 381
Comment stearoyl-CoA 9-desaturase [Mycobacterium kansasii ATCC 12478]
Sequence
MSKKNAVVNAKVADTRRPAVAGADRHPGWHALRKIAERITTPLLPDDYLQLANPLWSARE
LRGRILEVRRETEDSATLVIKPGWGFSFDYQPGQYIGIGLLVDGRWRWRSYSLTSSPVGT
TGSARTVTITVKAMPEGFLSTHLVAGVEPGTVVRLAAPQGNFVLPDPAPRSMLFVTAGSG
ITPVMSMLRTLVRRNQITDIAHLHSAPTEADVMFGAELAALTDDHPGYRLKVRTTRTEGR
LDLARLGEEVPDWRDRQTWACGPAAMLNQAEKVWAAAGVSDRLHLERFAVSKAAPAGAGG
TVTFARSGRSVAADAATSVMDAGEGAGVQMPFGCRMGICQSCVVDLVAGHVRDLRTGQEH
DPGTRIQTCVSAASGDCVVDI
Download sequence
Identical sequences U5WTZ4 X7YDM8 X7ZSS3
WP_023371652.1.16017 WP_023371652.1.23645 WP_023371652.1.34812 WP_023371652.1.43690 WP_023371652.1.43814 WP_023371652.1.6362 WP_023371652.1.64499 WP_023371652.1.72138 WP_023371652.1.74408 WP_023371652.1.75720 WP_023371652.1.82574 WP_023371652.1.8461 WP_023371652.1.98687 gi|556583648|ref|YP_008751809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]