SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389869730|ref|YP_006377153.1| from Enterococcus faecium DO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389869730|ref|YP_006377153.1|
Domain Number 1 Region: 24-240
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.11e-58
Family PP-loop ATPase 0.00014
Further Details:      
 
Domain Number 2 Region: 389-444
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000157
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389869730|ref|YP_006377153.1|
Sequence length 481
Comment PP-loop family ATPase [Enterococcus faecium DO]
Sequence
MNVEKGGKKAPLLQQSFIRHGNEQGFWQQGSRILAAVSGGVDSMVLLHLLLQVQRQIGFS
LGIVHINHQLREESAEEAAYLRSYCEEKNLPLYVSIWEDPAKSAIETEARNFRYQEFTRV
MEEGQYDTLMTAHHGDDQIETVLMKIVRGGQLNTFSGIKEVQPFATGRLIRPLLSFSKED
LYTYAAESQLVYFEDQTNQLLDIQRNRLRHLVVPQLKQENTQALRHFQQFSQQIQWADQV
IQKYMGQLIEKEVEQWEEQFRFSAEMIEEMTDAERYYFFYSFFDKAFSKTGIILKEQQME
SILDQWQQKKSQWQLSIGNNWILKREYHFVVLSKKEKQATSQTEDQRLLLIPEQGIYLNE
TEWIGLVKPENAGDIKATDSWSLFSHDIWIPADVQLYVEKRKAGDRIKLTENLTKKVSRY
FIDQKVPNSQRQHAWIITDAKRNIYSLIPFAFSYLSIREETDKIHYILLYKYQKEAIGRR
T
Download sequence
Identical sequences A0A0M1XEE9 A0A0M2AY49 A0A133CQL0 J6PY60 Q3Y177 T4ISZ0
WP_002287414.1.100098 WP_002287414.1.100305 WP_002287414.1.100328 WP_002287414.1.100428 WP_002287414.1.100439 WP_002287414.1.100544 WP_002287414.1.10087 WP_002287414.1.101134 WP_002287414.1.101415 WP_002287414.1.101637 WP_002287414.1.101870 WP_002287414.1.102035 WP_002287414.1.102112 WP_002287414.1.10354 WP_002287414.1.10380 WP_002287414.1.10519 WP_002287414.1.10650 WP_002287414.1.10803 WP_002287414.1.10875 WP_002287414.1.11275 WP_002287414.1.11423 WP_002287414.1.11547 WP_002287414.1.11704 WP_002287414.1.11916 WP_002287414.1.12002 WP_002287414.1.12178 WP_002287414.1.12708 WP_002287414.1.13042 WP_002287414.1.13453 WP_002287414.1.13631 WP_002287414.1.13694 WP_002287414.1.13905 WP_002287414.1.1455 WP_002287414.1.14642 WP_002287414.1.14727 WP_002287414.1.14760 WP_002287414.1.14828 WP_002287414.1.15013 WP_002287414.1.15070 WP_002287414.1.15101 WP_002287414.1.15144 WP_002287414.1.15198 WP_002287414.1.15604 WP_002287414.1.15879 WP_002287414.1.16346 WP_002287414.1.16507 WP_002287414.1.16712 WP_002287414.1.16827 WP_002287414.1.17140 WP_002287414.1.17488 WP_002287414.1.17573 WP_002287414.1.17607 WP_002287414.1.17636 WP_002287414.1.17742 WP_002287414.1.1776 WP_002287414.1.17764 WP_002287414.1.17898 WP_002287414.1.17916 WP_002287414.1.18015 WP_002287414.1.18183 WP_002287414.1.18269 WP_002287414.1.18622 WP_002287414.1.18700 WP_002287414.1.1878 WP_002287414.1.19395 WP_002287414.1.19482 WP_002287414.1.19499 WP_002287414.1.19582 WP_002287414.1.19708 WP_002287414.1.19805 WP_002287414.1.19916 WP_002287414.1.20098 WP_002287414.1.201 WP_002287414.1.20150 WP_002287414.1.20485 WP_002287414.1.20896 WP_002287414.1.21108 WP_002287414.1.21268 WP_002287414.1.21659 WP_002287414.1.21664 WP_002287414.1.21769 WP_002287414.1.22311 WP_002287414.1.22488 WP_002287414.1.23055 WP_002287414.1.23063 WP_002287414.1.23147 WP_002287414.1.23327 WP_002287414.1.23398 WP_002287414.1.23414 WP_002287414.1.23429 WP_002287414.1.23691 WP_002287414.1.23697 WP_002287414.1.23712 WP_002287414.1.23774 WP_002287414.1.238 WP_002287414.1.23980 WP_002287414.1.24193 WP_002287414.1.24789 WP_002287414.1.25011 WP_002287414.1.25014 WP_002287414.1.25113 WP_002287414.1.25133 WP_002287414.1.25521 WP_002287414.1.25646 WP_002287414.1.25648 WP_002287414.1.25691 WP_002287414.1.25730 WP_002287414.1.2628 WP_002287414.1.26478 WP_002287414.1.26559 WP_002287414.1.26561 WP_002287414.1.2657 WP_002287414.1.26860 WP_002287414.1.26902 WP_002287414.1.26937 WP_002287414.1.27035 WP_002287414.1.2728 WP_002287414.1.2733 WP_002287414.1.27407 WP_002287414.1.27429 WP_002287414.1.27702 WP_002287414.1.2773 WP_002287414.1.28012 WP_002287414.1.28262 WP_002287414.1.2864 WP_002287414.1.28685 WP_002287414.1.28873 WP_002287414.1.29053 WP_002287414.1.29068 WP_002287414.1.29345 WP_002287414.1.29432 WP_002287414.1.29641 WP_002287414.1.29776 WP_002287414.1.30001 WP_002287414.1.3001 WP_002287414.1.30069 WP_002287414.1.30223 WP_002287414.1.30375 WP_002287414.1.31003 WP_002287414.1.31073 WP_002287414.1.31636 WP_002287414.1.31923 WP_002287414.1.31965 WP_002287414.1.32195 WP_002287414.1.32360 WP_002287414.1.3246 WP_002287414.1.32727 WP_002287414.1.32753 WP_002287414.1.3313 WP_002287414.1.33173 WP_002287414.1.33231 WP_002287414.1.33273 WP_002287414.1.33323 WP_002287414.1.33478 WP_002287414.1.3352 WP_002287414.1.33590 WP_002287414.1.33593 WP_002287414.1.34020 WP_002287414.1.34221 WP_002287414.1.34354 WP_002287414.1.34691 WP_002287414.1.34701 WP_002287414.1.35140 WP_002287414.1.35158 WP_002287414.1.35212 WP_002287414.1.35302 WP_002287414.1.35456 WP_002287414.1.35788 WP_002287414.1.358 WP_002287414.1.36052 WP_002287414.1.36337 WP_002287414.1.36428 WP_002287414.1.36777 WP_002287414.1.36804 WP_002287414.1.37139 WP_002287414.1.37151 WP_002287414.1.37318 WP_002287414.1.37531 WP_002287414.1.37552 WP_002287414.1.37630 WP_002287414.1.38074 WP_002287414.1.38149 WP_002287414.1.38191 WP_002287414.1.38331 WP_002287414.1.38458 WP_002287414.1.38915 WP_002287414.1.38981 WP_002287414.1.3938 WP_002287414.1.39565 WP_002287414.1.39617 WP_002287414.1.40052 WP_002287414.1.40077 WP_002287414.1.40180 WP_002287414.1.4026 WP_002287414.1.40387 WP_002287414.1.40514 WP_002287414.1.40529 WP_002287414.1.40562 WP_002287414.1.40575 WP_002287414.1.40630 WP_002287414.1.4065 WP_002287414.1.40749 WP_002287414.1.4099 WP_002287414.1.41051 WP_002287414.1.41285 WP_002287414.1.41320 WP_002287414.1.41509 WP_002287414.1.4176 WP_002287414.1.41869 WP_002287414.1.4200 WP_002287414.1.42529 WP_002287414.1.43163 WP_002287414.1.43692 WP_002287414.1.43823 WP_002287414.1.44098 WP_002287414.1.44429 WP_002287414.1.44557 WP_002287414.1.44585 WP_002287414.1.44822 WP_002287414.1.44874 WP_002287414.1.44909 WP_002287414.1.44952 WP_002287414.1.45007 WP_002287414.1.45174 WP_002287414.1.45423 WP_002287414.1.45529 WP_002287414.1.45650 WP_002287414.1.45681 WP_002287414.1.45710 WP_002287414.1.45735 WP_002287414.1.45899 WP_002287414.1.46020 WP_002287414.1.46063 WP_002287414.1.46230 WP_002287414.1.46452 WP_002287414.1.46516 WP_002287414.1.46544 WP_002287414.1.46658 WP_002287414.1.46917 WP_002287414.1.47031 WP_002287414.1.47169 WP_002287414.1.47481 WP_002287414.1.47528 WP_002287414.1.47752 WP_002287414.1.47841 WP_002287414.1.47945 WP_002287414.1.48041 WP_002287414.1.48400 WP_002287414.1.48409 WP_002287414.1.48679 WP_002287414.1.49013 WP_002287414.1.491 WP_002287414.1.49384 WP_002287414.1.49395 WP_002287414.1.49529 WP_002287414.1.49691 WP_002287414.1.50124 WP_002287414.1.50286 WP_002287414.1.50414 WP_002287414.1.50609 WP_002287414.1.50809 WP_002287414.1.50878 WP_002287414.1.50891 WP_002287414.1.51057 WP_002287414.1.51199 WP_002287414.1.51252 WP_002287414.1.51584 WP_002287414.1.5159 WP_002287414.1.51612 WP_002287414.1.51895 WP_002287414.1.51972 WP_002287414.1.52153 WP_002287414.1.52239 WP_002287414.1.5246 WP_002287414.1.52683 WP_002287414.1.5286 WP_002287414.1.52912 WP_002287414.1.53033 WP_002287414.1.54270 WP_002287414.1.54339 WP_002287414.1.54461 WP_002287414.1.54852 WP_002287414.1.54853 WP_002287414.1.55044 WP_002287414.1.55260 WP_002287414.1.55308 WP_002287414.1.55462 WP_002287414.1.55697 WP_002287414.1.56539 WP_002287414.1.56694 WP_002287414.1.56718 WP_002287414.1.56820 WP_002287414.1.56838 WP_002287414.1.56895 WP_002287414.1.5700 WP_002287414.1.57144 WP_002287414.1.57467 WP_002287414.1.58377 WP_002287414.1.5839 WP_002287414.1.5863 WP_002287414.1.58750 WP_002287414.1.58779 WP_002287414.1.58804 WP_002287414.1.58928 WP_002287414.1.60393 WP_002287414.1.60535 WP_002287414.1.60612 WP_002287414.1.60821 WP_002287414.1.61331 WP_002287414.1.61826 WP_002287414.1.61884 WP_002287414.1.6200 WP_002287414.1.62072 WP_002287414.1.62123 WP_002287414.1.62179 WP_002287414.1.62353 WP_002287414.1.62385 WP_002287414.1.62406 WP_002287414.1.62582 WP_002287414.1.62626 WP_002287414.1.62679 WP_002287414.1.62930 WP_002287414.1.63089 WP_002287414.1.6311 WP_002287414.1.63121 WP_002287414.1.6344 WP_002287414.1.63523 WP_002287414.1.63994 WP_002287414.1.64083 WP_002287414.1.64252 WP_002287414.1.64454 WP_002287414.1.64934 WP_002287414.1.6502 WP_002287414.1.65160 WP_002287414.1.65170 WP_002287414.1.65360 WP_002287414.1.65424 WP_002287414.1.65446 WP_002287414.1.65447 WP_002287414.1.65502 WP_002287414.1.65521 WP_002287414.1.66042 WP_002287414.1.66419 WP_002287414.1.66493 WP_002287414.1.66649 WP_002287414.1.66963 WP_002287414.1.67032 WP_002287414.1.6709 WP_002287414.1.67323 WP_002287414.1.67331 WP_002287414.1.67518 WP_002287414.1.68042 WP_002287414.1.68129 WP_002287414.1.68536 WP_002287414.1.6855 WP_002287414.1.68836 WP_002287414.1.69084 WP_002287414.1.69201 WP_002287414.1.69436 WP_002287414.1.69533 WP_002287414.1.69633 WP_002287414.1.69879 WP_002287414.1.69897 WP_002287414.1.69942 WP_002287414.1.70021 WP_002287414.1.70076 WP_002287414.1.70109 WP_002287414.1.7025 WP_002287414.1.70405 WP_002287414.1.70468 WP_002287414.1.70482 WP_002287414.1.70506 WP_002287414.1.70697 WP_002287414.1.70998 WP_002287414.1.71049 WP_002287414.1.71107 WP_002287414.1.7137 WP_002287414.1.71593 WP_002287414.1.71711 WP_002287414.1.71743 WP_002287414.1.72110 WP_002287414.1.72195 WP_002287414.1.72273 WP_002287414.1.72658 WP_002287414.1.72807 WP_002287414.1.72952 WP_002287414.1.73077 WP_002287414.1.73179 WP_002287414.1.73250 WP_002287414.1.73552 WP_002287414.1.73702 WP_002287414.1.7372 WP_002287414.1.73997 WP_002287414.1.74022 WP_002287414.1.74093 WP_002287414.1.74527 WP_002287414.1.74707 WP_002287414.1.74749 WP_002287414.1.75235 WP_002287414.1.75278 WP_002287414.1.75417 WP_002287414.1.75579 WP_002287414.1.75619 WP_002287414.1.75916 WP_002287414.1.762 WP_002287414.1.76578 WP_002287414.1.76647 WP_002287414.1.76730 WP_002287414.1.77231 WP_002287414.1.7734 WP_002287414.1.77466 WP_002287414.1.7753 WP_002287414.1.77560 WP_002287414.1.77772 WP_002287414.1.77804 WP_002287414.1.78190 WP_002287414.1.78244 WP_002287414.1.78271 WP_002287414.1.78431 WP_002287414.1.78770 WP_002287414.1.78818 WP_002287414.1.78882 WP_002287414.1.7911 WP_002287414.1.79859 WP_002287414.1.80023 WP_002287414.1.80031 WP_002287414.1.80073 WP_002287414.1.80238 WP_002287414.1.80369 WP_002287414.1.80377 WP_002287414.1.80413 WP_002287414.1.81011 WP_002287414.1.81222 WP_002287414.1.81451 WP_002287414.1.81636 WP_002287414.1.81642 WP_002287414.1.81868 WP_002287414.1.81958 WP_002287414.1.82000 WP_002287414.1.82415 WP_002287414.1.82658 WP_002287414.1.82689 WP_002287414.1.82745 WP_002287414.1.82949 WP_002287414.1.83170 WP_002287414.1.83339 WP_002287414.1.83362 WP_002287414.1.83532 WP_002287414.1.83549 WP_002287414.1.83571 WP_002287414.1.83768 WP_002287414.1.8382 WP_002287414.1.83927 WP_002287414.1.83988 WP_002287414.1.84089 WP_002287414.1.84223 WP_002287414.1.84281 WP_002287414.1.84327 WP_002287414.1.8439 WP_002287414.1.84804 WP_002287414.1.85251 WP_002287414.1.85358 WP_002287414.1.85407 WP_002287414.1.85457 WP_002287414.1.85666 WP_002287414.1.85739 WP_002287414.1.86051 WP_002287414.1.86077 WP_002287414.1.8634 WP_002287414.1.86409 WP_002287414.1.86565 WP_002287414.1.86824 WP_002287414.1.86884 WP_002287414.1.87018 WP_002287414.1.87637 WP_002287414.1.87657 WP_002287414.1.87906 WP_002287414.1.87908 WP_002287414.1.88005 WP_002287414.1.88065 WP_002287414.1.88273 WP_002287414.1.88323 WP_002287414.1.88325 WP_002287414.1.88466 WP_002287414.1.88545 WP_002287414.1.88637 WP_002287414.1.88691 WP_002287414.1.89031 WP_002287414.1.89062 WP_002287414.1.89307 WP_002287414.1.89323 WP_002287414.1.89356 WP_002287414.1.89538 WP_002287414.1.89566 WP_002287414.1.89774 WP_002287414.1.89778 WP_002287414.1.89986 WP_002287414.1.90107 WP_002287414.1.90267 WP_002287414.1.90494 WP_002287414.1.90500 WP_002287414.1.9065 WP_002287414.1.9080 WP_002287414.1.91050 WP_002287414.1.9126 WP_002287414.1.91657 WP_002287414.1.91658 WP_002287414.1.91962 WP_002287414.1.92113 WP_002287414.1.92197 WP_002287414.1.92343 WP_002287414.1.92566 WP_002287414.1.9257 WP_002287414.1.92721 WP_002287414.1.92899 WP_002287414.1.93128 WP_002287414.1.93166 WP_002287414.1.93344 WP_002287414.1.93591 WP_002287414.1.93831 WP_002287414.1.93941 WP_002287414.1.9415 WP_002287414.1.94185 WP_002287414.1.94197 WP_002287414.1.94314 WP_002287414.1.94583 WP_002287414.1.94632 WP_002287414.1.94744 WP_002287414.1.94793 WP_002287414.1.94846 WP_002287414.1.95510 WP_002287414.1.95538 WP_002287414.1.95741 WP_002287414.1.96390 WP_002287414.1.96581 WP_002287414.1.96767 WP_002287414.1.96927 WP_002287414.1.96948 WP_002287414.1.97766 WP_002287414.1.97952 WP_002287414.1.98228 WP_002287414.1.9824 WP_002287414.1.98407 WP_002287414.1.98458 WP_002287414.1.98469 WP_002287414.1.98720 WP_002287414.1.98772 WP_002287414.1.9881 WP_002287414.1.98815 WP_002287414.1.98831 WP_002287414.1.98845 WP_002287414.1.98940 WP_002287414.1.99032 WP_002287414.1.9913 WP_002287414.1.99380 WP_002287414.1.99437 WP_002287414.1.9948 YP_006377153.1.11553 gi|389869730|ref|YP_006377153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]