SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392988095|ref|YP_006486688.1| from Enterococcus hirae ATCC 9790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392988095|ref|YP_006486688.1|
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily YheA/YmcA-like 5.49e-21
Family YmcA-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392988095|ref|YP_006486688.1|
Sequence length 124
Comment hypothetical protein EHR_04135 [Enterococcus hirae ATCC 9790]
Sequence
MHKEPNIQREADKLAQLLSEHETIIRYHELERKVQTSSYLEKLTEDIKSAQKEAANYAYY
GKRIAEKEANGRVEQLTKQFDQHPIVVAYRKQLLEANDLLHHLTKMLQDEINNWIEEEDN
ASKN
Download sequence
Identical sequences A0A1V8XAX2 A0A219BTI1 A0A219C4U7 I6SWM5
gi|392988095|ref|YP_006486688.1| WP_010736830.1.101606 WP_010736830.1.13073 WP_010736830.1.17760 WP_010736830.1.32937 WP_010736830.1.33700 WP_010736830.1.36811 WP_010736830.1.47581 WP_010736830.1.48331 WP_010736830.1.50294 WP_010736830.1.54673 WP_010736830.1.54912 WP_010736830.1.63954 WP_010736830.1.67708 WP_010736830.1.67721 WP_010736830.1.68455 WP_010736830.1.73080 WP_010736830.1.73203 WP_010736830.1.75167 WP_010736830.1.79216 WP_010736830.1.82770 WP_010736830.1.99052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]