SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392988547|ref|YP_006487140.1| from Enterococcus hirae ATCC 9790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392988547|ref|YP_006487140.1|
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily YheA/YmcA-like 3.01e-36
Family YheA-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392988547|ref|YP_006487140.1|
Sequence length 113
Comment hypothetical protein EHR_06550 [Enterococcus hirae ATCC 9790]
Sequence
MSNIYDSANQIEREIRELQEFKALEEAYAKVKANEEAHRLFKDFQAMQIELQEKQMSGQE
FSDEDAMKAQEMAMKIQSEEVINDLMQKEQQFSTIINDLNRIIMTPVRDLYSE
Download sequence
Identical sequences A0A1V8X7X7 A0A219BAT4 A0A219BK11 A0A219BMU6 A0A219BVJ7 A0A219BY72 I6TAF4
WP_010720913.1.101606 WP_010720913.1.13073 WP_010720913.1.17760 WP_010720913.1.32937 WP_010720913.1.33700 WP_010720913.1.36811 WP_010720913.1.37026 WP_010720913.1.40466 WP_010720913.1.46229 WP_010720913.1.47581 WP_010720913.1.48331 WP_010720913.1.50294 WP_010720913.1.54673 WP_010720913.1.54912 WP_010720913.1.63954 WP_010720913.1.65049 WP_010720913.1.67708 WP_010720913.1.67721 WP_010720913.1.68455 WP_010720913.1.73080 WP_010720913.1.73203 WP_010720913.1.75167 WP_010720913.1.79216 WP_010720913.1.82770 WP_010720913.1.99052 gi|392988547|ref|YP_006487140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]