SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392988407|ref|YP_006487000.1| from Enterococcus hirae ATCC 9790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392988407|ref|YP_006487000.1|
Domain Number 1 Region: 20-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.67e-57
Family PP-loop ATPase 0.0000874
Further Details:      
 
Domain Number 2 Region: 387-442
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000968
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392988407|ref|YP_006487000.1|
Sequence length 480
Comment tRNA(Ile)-lysidine synthase [Enterococcus hirae ATCC 9790]
Sequence
MEEEQDARKIRQRFLTNCEINGYLNEQTRALLAVSGGVDSMVLLDLMMEAQKKWGFFLAV
THINHQLREESVHEVAYLKKYCQQHQLPLQVEVWEKPTKKGIETAAREFRYQVFAKQMQS
GSYDCLMTAHHGDDQMETVLMKLLRGGQLSTYAGIKEAQPFSNGRLIRPLLGFSKAQLYQ
YASERELVYFEDHTNQELDVQRNRLRHLVLPQLKQENPQAMVHFQRFSQQIQWADRLIQT
HMKKVLMENVVEENERVHFPWKLLAEMPEEENYYFLYAFFDHFFEKTAIVIKEKQIQLIL
QQCQQKKGQWKITLERGWVLQRSYEKIYLIQEKADPSKTIQERTEAHKLELNQRIRLDES
CWIGLFTPEAAEEARKADDWDEFSHDLWLSSHQELFVGKRQAGERIQLNSKLKKKISRYL
IDNKVPDSQRKEAWVVRDQNENIYSLVPFTYSYLSIGVETDKIHYILLYKYHKEAIGRRT
Download sequence
Identical sequences I6TA47
gi|392988407|ref|YP_006487000.1| WP_010737291.1.13073 WP_010737291.1.33700 WP_010737291.1.47581 WP_010737291.1.48331 WP_010737291.1.54912 WP_010737291.1.63954 WP_010737291.1.67721 WP_010737291.1.73203 WP_010737291.1.75167 WP_010737291.1.82770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]