SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331970|ref|NP_442698.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331970|ref|NP_442698.1|
Domain Number 1 Region: 493-591
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000000366
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 429-490
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000719
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|16331970|ref|NP_442698.1|
Domain Number - Region: 376-427
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00107
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331970|ref|NP_442698.1|
Sequence length 617
Comment hypothetical protein slr0765 [Synechocystis sp. PCC 6803]
Sequence
MPLITKLKKYRRKYKRFFWLGCVVLALLLIIPHPSQAQFVMPQGFSGQGSGYKPPEVSRY
GPIEVAPVRSPVDNGFLFDVASPTVYNRQENTSQIPVEQRAQDIESKLELAIFRRDMNPD
DLRVETSRLNNVVVVTVSNDDYPLPLVLASVTENDADFNGQPIDVLAEQWREKLDKEIRR
GQASTTPEALEQSFKQAFQIFVALLVATAIVASIKHLISRHRQRLLNRKQAIAAEKQANS
EVLEENHPDPIEVNYAAPEILGEQQWIFWQRLPQILSIDRKIGFWKFIQWLLFWVIILGW
YFGLFAIFRQIPGLATLSGAILGRPLQLLMLWFFVGLTIRISHRIIELLKDNWQNTNSTS
FNKFINLGDDQRRDLRISTISGAIKGMVTVVISASGLLTALIILGIPTGSVVAIGGLLAL
AISFGAQSLVKDLVDGFLVLAEDQYAIGDVIDVGFAAGGVENLNLRVTQLRSAGGELVTI
PNSAITQVKNLTRSWSRANLSVNVAYDTDPVKAINVLRQVGEDLYNDPEWHDKMLAVPDV
LGIDSLTHEGMTITIWIQTAPAQQWSVGRELRFRVRQALTENNIEIGAPRQIYAHATNTT
NGATNPPFNALESAVES
Download sequence
Identical sequences L8AQ19 Q55987
gi|16331970|ref|NP_442698.1| gi|16331970|ref|NP_442698.1| gi|383323713|ref|YP_005384567.1| gi|383326882|ref|YP_005387736.1| 1148.slr0765 WP_010873993.1.11876 WP_010873993.1.1889 WP_010873993.1.18904 WP_010873993.1.33690 WP_010873993.1.35395 WP_010873993.1.47586 WP_010873993.1.99424 gi|383492766|ref|YP_005410443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]