SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332066|ref|NP_442794.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332066|ref|NP_442794.1|
Domain Number 1 Region: 107-249
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.31e-32
Family Potassium channel NAD-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-131
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-17
Family Voltage-gated potassium channels 0.0043
Further Details:      
 
Domain Number 3 Region: 254-340
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 3.27e-17
Family TrkA C-terminal domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332066|ref|NP_442794.1|
Sequence length 356
Comment hypothetical protein sll0536 [Synechocystis sp. PCC 6803]
Sequence
MQDSNQRLKLGVLFFVVTLVLATLGYICFGWTTTEAVYMVVITVFGVGYGEVRPLTTTAE
RVFTMGVILAGTTSAVYIVGAFVQMVTEGEIHRALGNQQRQRQIANLTDHTIICGFGRMG
QVLAKQLKQSGLPFSIIDNQPSQVAIAEELGYLAHCGDATREEQLQMLGVMRAKTLATVL
PEDATNVFITLTARELNSRLTILARGEIPETERKLRLAGADQVILPLTVGAVQMADLITQ
SNRRDFLNRPDERGFLNDLLASVEVQMDELIVAPDSPAMGRTIMEMEVRSKGAFIVIALR
RADGSTILHPHPSQILNENDTIIVIGHRSEIPRFAEQYQFKRKQLKARWQEAALTP
Download sequence
Identical sequences Q55509
gi|16332066|ref|NP_442794.1| gi|383323809|ref|YP_005384663.1| gi|16332066|ref|NP_442794.1| WP_010874088.1.11876 WP_010874088.1.1889 WP_010874088.1.18904 WP_010874088.1.33690 WP_010874088.1.35395 WP_010874088.1.47586 WP_010874088.1.99424 gi|383326978|ref|YP_005387832.1| 1148.sll0536 gi|383492862|ref|YP_005410539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]