SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387871051|ref|YP_005802424.1| from Erwinia pyrifoliae DSM 12163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387871051|ref|YP_005802424.1|
Domain Number 1 Region: 3-242
Classification Level Classification E-value
Superfamily CutC-like 4.58e-77
Family CutC-like 0.0000000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387871051|ref|YP_005802424.1|
Sequence length 250
Comment copper homeostasis protein cutC [Erwinia pyrifoliae DSM 12163]
Sequence
MRQLEICCYGVECAVTAERAGADRIELCTAPTEGGLTPSAGALRSARQRVGIPVHPIVRP
RGGDFCYSDGEFDQIKSDIAFIRELGFPGLVIGLLDVDGHVDLPRMRQVMQLCQGMDITF
HRAFDLCHNPLAALAQIADLGVTRILTSGQQQSAESGLPLLRELTRQAGGPIIMAGAGVR
LSNLQKFIDAGVMEIHSSASQRISSTMRYRKAGVSMCSEAENDEFSRTCVDADVVAAMKS
VLMASPEQVA
Download sequence
Identical sequences D2T9T5
gi|259908208|ref|YP_002648564.1| gi|387871051|ref|YP_005802424.1| 634499.EpC_15530 WP_012667865.1.53124 WP_012667865.1.74942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]