SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479152343|ref|YP_007782118.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479152343|ref|YP_007782118.1|
Domain Number 1 Region: 15-188
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.36e-22
Family Archaeal IMP cyclohydrolase PurO 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479152343|ref|YP_007782118.1|
Sequence length 237
Comment IMP cyclohydrolase-like protein [Ruminococcus sp. SR1/5]
Sequence
MTTFSLEKELKENSYPGRGIVIGRSADGKHAVTAYFIMGRSENSRNRIFVEDGEGIRTQA
FDPSKLTDPSLIIYAPVRVLGNKTIVTNGDQTDTIYEGMDRQLTFEQSLRSREFEPDAPN
YTPRISGVLHVEDGKFNYAMSILKSNNGNPDSCLRYTFAYENAAAGQGRFIHTYKCDGNP
LPSFEGEPKLVEIPSDIDEFTDLLWKSLNQDNKVSLFVRFIDIETGKYESRIVNKNK
Download sequence
Identical sequences A0A1C5MSC0 D4LPF4 U2D2L9
WP_015524355.1.100942 WP_015524355.1.94155 2004042024 gi|479152343|ref|YP_007782118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]