SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479152430|ref|YP_007782205.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479152430|ref|YP_007782205.1|
Domain Number - Region: 25-88
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0628
Family B3/B4 domain of PheRS, PheT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479152430|ref|YP_007782205.1|
Sequence length 154
Comment hypothetical protein CK1_01760 [Ruminococcus sp. SR1/5]
Sequence
MKIIKNILIIIGAVLLLNYIVYLPMCVDDYIREESEVYSVQNAYRSFTLHKNSAHEIKQT
MLPFLFALPLNRKDYIFDVTNNFYAIINISVYIWQFPRANISGIIAKNERMFGSVSQKPD
IYCNVGGNCNREGYLWIIRKRLLRWLKNARIIIG
Download sequence
Identical sequences D4LPP1
gi|479152430|ref|YP_007782205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]