SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479152720|ref|YP_007782495.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479152720|ref|YP_007782495.1|
Domain Number 1 Region: 3-22,177-391
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.99e-32
Family FolH catalytic domain-like 0.065
Further Details:      
 
Domain Number 2 Region: 50-156
Classification Level Classification E-value
Superfamily PA domain 0.0000000129
Family PA domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479152720|ref|YP_007782495.1|
Sequence length 630
Comment Predicted aminopeptidases [Ruminococcus sp. SR1/5]
Sequence
MLLEEMKKAGLTQVEKDKIRVDAWEFKKAVMRCHDREGTCREIQLGAYQTDFKTNGFQRF
DLVYLGKGTADEYKDIDVKGKLVLIEINQREEWWINYPVYQAHLKGAAALIAVQSRGYAQ
IDDTALNAQDIAGPSCAPAFSMSRADFLMIRQLMEEKNENGNRVPELSVEFDADTEVIKD
QYTYNIVGKIPGTDSDSMILLSAHYDSYFEGFQDDNAAVAMIIGIARALLRGGYKPRHTI
VVCALAAEEWGISDTKYDWSTGAYRQVFEARPEWQGHVIADLNFELPAHAHSTRDAVRCT
YEYADFVRSFVDAVQMPEGIYPEGMTTLYPIETWSDDFTMAISGIPSMVNDFSGGPFMEN
YYHSQYDNQDVYEEEVYRFHHEFYLKLLLAIDGLALPPMDFGRVLDQSIKTLETDLCMQT
GADSTLLLKKTEEAKKAAAILAEQVRHFNSLPEEKRDWKKADAITEKLLGVFRKSQDYLV
RLDWDDNVIFPQQAVQNNLYALKKAMGYLEKGEIAPALEAFYSIDNNCYAFQFEREVFYH
FTEYILKQSPDRLMWGKGRIIHHENLYDLVESLKEKKPGDSLEAEKQSLKEAWERQKRYY
ADDIEYLIRAVEKLRNLICEVSDMFEKGTE
Download sequence
Identical sequences D4LG71
gi|479152720|ref|YP_007782495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]